KEGG   Sphingobium baderi: ATN00_08030Help
Entry
ATN00_08030       CDS       T04194                                 

Definition
(GenBank) siroheme synthase
  KO
K02302  uroporphyrin-III C-methyltransferase / precorrin-2 dehydrogenase / sirohydrochlorin ferrochelatase [EC:2.1.1.107 1.3.1.76 4.99.1.4]
Organism
sbd  Sphingobium baderi
Pathway
sbd00860  Porphyrin and chlorophyll metabolism
sbd01100  Metabolic pathways
sbd01110  Biosynthesis of secondary metabolites
sbd01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sbd00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    ATN00_08030
Enzymes [BR:sbd01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.76  precorrin-2 dehydrogenase
     ATN00_08030
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.107  uroporphyrinogen-III C-methyltransferase
     ATN00_08030
 4. Lyases
  4.99  Other lyases
   4.99.1  Sole sub-subclass for lyases that do not belong in the other subclasses
    4.99.1.4  sirohydrochlorin ferrochelatase
     ATN00_08030
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NAD_binding_7 TP_methylase Sirohm_synth_M PALP
Motif
Other DBs
NCBI-ProteinID: ALR20263
UniProt: A0A0S3EY02
Position
1607991..1608758
Genome map
AA seq 255 aa AA seqDB search
MHSLPVFLRLRGRAVILIGEGEAADAKRRLLERAGARVVGEEAEAALAIVANGDEAAVAR
LKGRGVLVNATDRPELCDFTLPAIVDRDPVLIAVGTGGASAGLAKALRQRIETLLPARLG
ALATALFEAREAIRMRWPDAAARRHAIDAGLAEGGPIDPLQGDADKSVATWLAGDIDRDA
RGLVAIRLASTDPDDLTLRTARLLGAADRIYHKPDVPVAILDRARADAARIIADAKPHGQ
EQGLTLWLEMAERRC
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgcacagcctgcccgtctttctgcgattacgcggacgggccgtgatcctgatcggcgag
ggtgaggcggcggacgccaagagacggctgctggagcgggccggggcgcgtgtcgtgggg
gaagaggcggaggctgcccttgccatcgtcgcgaatggggatgaagcggccgtggcgcgg
ctcaagggacggggcgtgctggtgaacgcgactgatcggccggaactgtgcgacttcacc
ttgcctgccattgtggatcgcgacccggtgctgatcgccgtcgggacgggtggcgcttcg
gcagggctggcgaaagccttgcggcaacggatcgagacgctgctgcccgcgcggctgggg
gctttggcgacggcattatttgaagcgcgggaagcgattcggatgcgatggcccgatgcg
gcggcgcggcggcacgccattgatgctggcctggccgagggcgggccgatcgacccgttg
cagggcgatgcggacaagagcgtggcgacctggctggcgggagacattgaccgggacgca
cgcgggctggtggcgatccgccttgcttccaccgatcccgatgatctgacgctgcggacg
gcgcggctgctgggcgcggcggaccgaatctaccataagccggatgtcccggtagcgata
ttggatcgcgcccgcgctgacgcagcgcggatcatcgcggatgcgaagccccatgggcag
gagcaagggctgactctctggctggagatggcagagcggcgttgttag

DBGET integrated database retrieval system