KEGG   Sphingobium baderi: ATN00_11710Help
Entry
ATN00_11710       CDS       T04194                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
sbd  Sphingobium baderi
Pathway
sbd00071  Fatty acid degradation
sbd00072  Synthesis and degradation of ketone bodies
sbd00280  Valine, leucine and isoleucine degradation
sbd00310  Lysine degradation
sbd00362  Benzoate degradation
sbd00380  Tryptophan metabolism
sbd00620  Pyruvate metabolism
sbd00630  Glyoxylate and dicarboxylate metabolism
sbd00640  Propanoate metabolism
sbd00650  Butanoate metabolism
sbd00900  Terpenoid backbone biosynthesis
sbd01100  Metabolic pathways
sbd01110  Biosynthesis of secondary metabolites
sbd01120  Microbial metabolism in diverse environments
sbd01130  Biosynthesis of antibiotics
sbd01200  Carbon metabolism
sbd01212  Fatty acid metabolism
sbd02020  Two-component system
Brite
KEGG Orthology (KO) [BR:sbd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    ATN00_11710
   00630 Glyoxylate and dicarboxylate metabolism
    ATN00_11710
   00640 Propanoate metabolism
    ATN00_11710
   00650 Butanoate metabolism
    ATN00_11710
  09103 Lipid metabolism
   00071 Fatty acid degradation
    ATN00_11710
   00072 Synthesis and degradation of ketone bodies
    ATN00_11710
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    ATN00_11710
   00310 Lysine degradation
    ATN00_11710
   00380 Tryptophan metabolism
    ATN00_11710
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    ATN00_11710
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    ATN00_11710
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ATN00_11710
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sbd04147]
    ATN00_11710
Enzymes [BR:sbd01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     ATN00_11710
Exosome [BR:sbd04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   ATN00_11710
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt DUF5423 ACP_syn_III ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: ALR20864
UniProt: A0A0S3EZL3
Position
complement(2378743..2379951)
Genome map
AA seq 402 aa AA seqDB search
MEAYIYDTVRTPRGRGKTDGSLHEITPIQLATQVLEGIRDRNGIDTADVDDVILGCVTPV
GEQGADIARVAVLNAGYAQTTPGVQISRFCASGLEAVNMAAGKVVSGEADFVVAGGVESM
SRVPMASDGGAWAMDPAVAYKTYFAPQGIGADVIATKFGFSRDDVDAYAVESQRRAKMAW
DEGRFARSILPVKDIIGRIALDHDEHMRPDATMQSLAALKPSFAALGEDMPGFDTVALLR
YPELEKVDHVHHAGNSSGIVDGAAGVLVGSKAIGEKYGLKPRARIRAAASIGSEPLIMLT
GPEFVAGKLLKRAGMSKADIDLWELNEAFAAVVLRYMQAMDLDHGLINVNGGAIAMGHPL
GATGAMVLGTALDELERTGKGTALVNLCVGAGMGTGTIIERI
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atggaagcctatatctacgacaccgtcaggacgccccggggccggggcaagaccgacggg
tcgctgcatgagatcacccccatccagcttgcgacgcaggtgttggaaggcatacgtgat
cgcaacggcatcgacaccgcagatgtggacgacgtcatactgggctgcgtcacgccggtg
ggcgagcagggcgcggacatcgcgcgcgtcgcggtgctgaacgcgggttacgcgcagacc
acgccgggcgtacagatcagccgcttttgcgcttcgggactcgaagcggtgaacatggcc
gcgggcaaggtcgtatcgggcgaagcggatttcgtcgtcgcgggcggcgtcgaatccatg
agccgggtgccgatggcgtcggatggcggcgcatgggccatggacccggccgtcgcctac
aaaacctatttcgcgccgcagggcatcggcgcggacgtgatcgcgaccaaattcggcttt
tcgcgggatgatgtcgacgcctatgcggtggagagccagcggcgcgcgaagatggcatgg
gacgaagggcgcttcgccagatccatcctgccggtgaaagacattatcggccgcatcgcg
ctggaccatgacgaacatatgcggcccgacgccacgatgcagtcgctcgccgccctgaaa
cccagcttcgccgcgctgggcgaggacatgccgggcttcgatacggtggcgctgctgcgc
tacccggaactggagaaggtcgatcatgtccaccatgcaggcaacagttccggcatcgtc
gacggcgccgcgggcgtactggtcggcagcaaggcgatcggcgagaaatatgggctgaaa
ccgcgcgcgcgcatccgcgcggcggcctccatcgggtccgaaccgctcatcatgctgacc
gggccggagttcgtcgcgggcaagctgctgaagcgcgcgggaatgagcaaggccgacatc
gacctgtgggaactgaacgaagcctttgccgccgtggtgctgcgctacatgcaggcgatg
gacctcgaccatggcctgatcaacgtcaatggcggcgcgatcgccatggggcatccgctg
ggcgcgaccggcgcgatggtgctgggcaccgcgctggatgaactggagcggacgggcaag
ggcaccgcgctcgtcaacctgtgcgtgggcgcgggcatgggcaccggcacgatcatcgag
cgtatttga

DBGET integrated database retrieval system