KEGG   Sphingobium baderi: ATN00_18420Help
Entry
ATN00_18420       CDS       T04194                                 

Definition
(GenBank) 5,10-methylenetetrahydrofolate reductase
  KO
K00297  methylenetetrahydrofolate reductase (NADPH) [EC:1.5.1.20]
Organism
sbd  Sphingobium baderi
Pathway
sbd00670  One carbon pool by folate
sbd01100  Metabolic pathways
sbd01120  Microbial metabolism in diverse environments
sbd01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sbd00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    ATN00_18420
Enzymes [BR:sbd01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.20  methylenetetrahydrofolate reductase [NAD(P)H]
     ATN00_18420
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MTHFR
Motif
Other DBs
NCBI-ProteinID: ALR21978
UniProt: A0A0S3F2R6
Position
complement(3772752..3773678)
Genome map
AA seq 308 aa AA seqDB search
MTLSFPSVEEARRALDAPLYADLAGDLNVSFEFFPPKTEKMEEQLWSAIETLTPLGPKFV
SVTYGAGGSTRERTHNTVARIAKETPLAAAAHLTCVAASKDEITEVADAYWDAGVRHIVA
LRGDPPVAGAKFEPHPQGYQGAAELVDGLVKRHPFEISVAAYPETHPDAASAQGDLDNLK
RKLDAGATRAITQFFFEPDTFFRFRDTAAAAGISADIIPGIMPVSNFAAVQRMSAMCNTD
VPLWMGRLFEGLDTLPAARQLVSATLAAELCRKLYAGGVRDFHFYTLNRAELSYAICHLL
GLRPEKSA
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgaccctcagcttcccctccgtcgaagaggcgcggcgcgcactggatgcgccgctctat
gccgatctggcgggcgaccttaacgtcagcttcgaattcttcccgcccaagacggagaag
atggaggagcagctctggtccgcgatcgagacgctgacgccgctggggccgaaattcgtt
tccgtcacctatggcgcgggcggttcgacgcgggagcgcactcacaacacggtggcgcgc
atcgcgaaggaaacgccgctcgccgccgccgcgcacctgacctgcgttgccgccagcaag
gacgagatcaccgaagtagccgatgcctattgggacgcgggcgtgcgccacatcgtcgcc
ctgcgcggtgatccgccggtggcaggcgcgaagttcgagccgcatccgcagggctatcag
ggcgcggccgaactggtcgatgggctggtgaaacgccatcccttcgagatttccgtggcc
gcctatcccgaaacgcaccccgatgcggcgagcgcccagggcgatctcgacaatctcaag
cgcaagctggacgcgggcgcgacccgcgccatcacgcaattctttttcgaaccggacacc
ttcttccgctttcgcgatacggcggcggcggcgggcatttcggcggacatcatccccggc
atcatgcccgtcagcaatttcgccgcggttcagcgcatgtcggccatgtgcaacaccgat
gtgccgctttggatgggtcgcctgttcgaggggctggacacgcttcccgccgcgcggcag
cttgtttccgcgacgctggcggcggagctttgccgcaagctttatgcgggcggagtgcgc
gacttccatttctatacactcaaccgtgcggaactcagttacgccatctgccatctgttg
ggcctgcgaccggagaaaagtgcatga

DBGET integrated database retrieval system