KEGG   Sphingobium baderi: ATN00_19545Help
Entry
ATN00_19545       CDS       T04194                                 

Definition
(GenBank) mannose-1-phosphate guanyltransferase
  KO
K00971  mannose-1-phosphate guanylyltransferase [EC:2.7.7.13]
Organism
sbd  Sphingobium baderi
Pathway
sbd00051  Fructose and mannose metabolism
sbd00520  Amino sugar and nucleotide sugar metabolism
sbd01100  Metabolic pathways
sbd01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sbd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    ATN00_19545
   00520 Amino sugar and nucleotide sugar metabolism
    ATN00_19545
Enzymes [BR:sbd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.13  mannose-1-phosphate guanylyltransferase
     ATN00_19545
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 DUF218 MannoseP_isomer
Motif
Other DBs
NCBI-ProteinID: ALR22178
UniProt: A0A0S3F3J9
Position
complement(4000669..4001775)
Genome map
AA seq 368 aa AA seqDB search
MSESDAAKGAQAPIYPVILSGGAGTRLWPLSRPETPKQFLTLLGTSTMMQETVARTTGRA
GFASPLVVSGERHVALVAQQIREAGSEPAAIFLEPEGRNTAGAIALAAYWLAERDGEALM
LIMPSDHAIADIESFHGAIAAACPAARAGRLVTFGIRPTHAETGYGYIEVGDALADVPGV
HRVAAFVEKPPLETARALIETGRHCWNGGIFLFSARAYVGELERLAPKVADACRSAMRAA
RDDGDYIRPDAVAFGACPSISIDYAIMEKTDTAVVVPVDMGWSDVGSWEALWMLKDRNGQ
DSICEGVAIDMDGRGNLVIVDGGPPVGTMGMRDCVIVSTAKGVLVMPRDRSADIRALAEA
MLKRTDGN
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgagcgagagcgacgcagcgaagggcgcgcaagcccccatctatcccgtcatcctgtcg
ggaggggcggggacgcgcctgtggcctttgtcccggccggaaacgcccaagcagttcctg
acgctgctcggcaccagcacgatgatgcaggaaaccgtcgcccgcacgactggtcgtgcc
gggttcgcgtcgccgttggtggtatcgggcgagcgtcatgtggcgctggtggcgcagcag
atccgggaggccggaagcgaaccggcggcgatctttcttgaaccggaaggacgcaacacg
gcaggcgcgatcgcgctggctgcctattggctggccgaacgggatggcgaggcgttgatg
ctgatcatgccgtccgatcatgcgatcgccgatatagagagctttcacggcgccatagca
gctgcgtgtccggcggcgcgtgccgggcggctggtgacattcggcattcgtccgactcac
gcggaaacgggttatggctatatcgaggtgggcgacgcgctggcggatgtgccgggcgtg
catcgggtcgcggcctttgtcgaaaagccgccgctggaaacggcgcgtgccctgattgag
acgggacggcattgctggaatggcggcattttcctgttttccgcccgcgcttatgtggga
gaactggaacggctggccccgaaagtggccgatgcctgccggtcggcgatgcgggccgcg
cgggacgatggcgattatattcgtcccgatgccgtggcctttggcgcatgtcccagcatc
tccatcgattatgcgatcatggaaaagacagacaccgccgtggtcgtgccggtcgatatg
ggatggtccgatgtcggctcctgggaagcgctctggatgctcaaggaccgcaacgggcaa
gacagcatttgcgaaggcgtggcgatcgacatggacggtcgtggcaatctggtcatcgtt
gatggcggtccgccggtaggcacaatggggatgcgcgattgcgtgatcgtgtcgacggcg
aaaggcgtgctggtcatgccgcgcgaccgctccgccgatattcgcgctctggccgaagcg
atgctcaagcggacggacgggaactga

DBGET integrated database retrieval system