KEGG   Sphingobium baderi: ATN00_20360Help
Entry
ATN00_20360       CDS       T04194                                 

Definition
(GenBank) hypothetical protein
Organism
sbd  Sphingobium baderi
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF736 KNTase_C
Motif
Other DBs
NCBI-ProteinID: ALR23008
UniProt: A0A0S3F5W6
Position
pDE1:55855..56301
Genome map
AA seq 148 aa AA seqDB search
MNIGTFAFKNGQLIGSIATLTVDLARLGLRPVESDNEKAPAFEIMALNVARKWVQVGALW
EATSNSTGEVFYQGSLDDPSLPEKMAIMVFGDDEDGYRVVWNRPAPMRQNMDGSRQTRRR
QRDDNFGEGNATEDGRIAQGEEDHVPAF
NT seq 447 nt NT seq  +upstreamnt  +downstreamnt
atgaacatcggtactttcgccttcaagaacggccagctcatcggttcgatcgcaaccctc
accgtcgaccttgcccgccttggccttcgccccgtcgaaagcgataacgagaaggccccc
gcgttcgagatcatggcgcttaacgtcgcccgcaagtgggtgcaggtcggcgcgctttgg
gaagcgaccagcaattcgaccggcgaggttttctatcagggaagccttgatgaccccagc
ctgcccgagaagatggcaatcatggtctttggtgacgacgaggacggctatcgcgtcgtc
tggaaccgtccggcccccatgcgccagaacatggacggcagccgccagacccgccgccgc
cagcgtgacgacaatttcggtgaaggcaacgcaaccgaagatggccgcatcgcacagggc
gaagaggatcacgtccccgcgttctaa

DBGET integrated database retrieval system