KEGG   Silvanigrellales bacterium RF1110005: JCM31447_25040Help
Entry
JCM31447_25040    CDS       T05949                                 

Definition
(GenBank) NAD-dependent epimerase/dehydratase family protein
  KO
K08678  UDP-glucuronate decarboxylase [EC:4.1.1.35]
Organism
sbf  Silvanigrellales bacterium RF1110005
Pathway
sbf00520  Amino sugar and nucleotide sugar metabolism
sbf01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sbf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    JCM31447_25040
Enzymes [BR:sbf01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.35  UDP-glucuronate decarboxylase
     JCM31447_25040
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GDP_Man_Dehyd Epimerase 3Beta_HSD Polysacc_synt_2 NAD_binding_4 RmlD_sub_bind
Motif
Other DBs
NCBI-ProteinID: BBH54047
Position
complement(2914003..2914956)
Genome map
AA seq 317 aa AA seqDB search
MNILVTGCAGFIAYHLIFTLLEQNHTIYGFDNFISGQKENIERLNILYPNNFVFKEFDLI
DFEKLNKFIYDIKIDQIYHLACPASPPIYQIDPLHTLDTCYIGTRNILEIARIKNSKILL
ASTSEIYGDPTVHPQPENYWGNVNSFGLRSCYDEGKRVSETLSFIYLKKGIDVKIVRIFN
TYGPKMSLNDGRVLTNFITQALRGENLTIYGDGSQTRSLCFCTDLIKGLLKLMDSNINMP
INLGSQFEIRIIEIAEIVKSIINPDIKLTFKPLPSDDPKQRRPDITNAKKYLDWEPQVGI
QEGISLMIKEFKERVKL
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgaatatattagtcacaggatgcgctggttttattgcatatcaccttatatttacgcta
ttagagcaaaaccatactatatatggttttgataattttataagtgggcaaaaggaaaat
attgaaagattaaatattttatatccaaataattttgtatttaaagaatttgatctcata
gattttgaaaaactaaataaatttatttatgacataaaaattgatcaaatatatcatttg
gcttgtccagcttcgccaccaatctatcaaatagatcctcttcatactcttgatacttgt
tacataggcactcgaaatattcttgaaattgctagaattaaaaattcaaaaatcctgctt
gcatcaacaagcgaaatttatggagacccaactgtccacccacaacctgaaaattattgg
gggaatgtcaatagttttggtctgcggagttgttatgatgaaggcaaacgtgtgtcagaa
acactctcttttatttacttgaaaaaaggaattgacgttaaaattgtgcgcatattcaat
acctatggccctaagatgtccttaaatgatggcagagttttaactaattttattactcaa
gctctgagaggcgaaaaccttactatctatggtgatggcagccaaacaagatctctttgc
ttttgtactgatcttataaaaggactgctaaaattgatggattctaatattaatatgcct
ataaatttgggatctcaatttgaaataagaattatagaaattgctgaaatagtcaaatcc
ataataaatccagatatcaaactaacttttaaaccactcccatcggatgatcctaaacaa
agaaggccagatattacgaatgctaaaaaatacttggattgggaacctcaagtaggtatt
caagaaggaatatctttaatgataaaggaatttaaagaaagggtaaaactgtga

DBGET integrated database retrieval system