KEGG   Salmonella bongori NCTC 12419: SBG_1180Help
Entry
SBG_1180          CDS       T01579                                 

Gene name
pfkB
Definition
(GenBank) 6-phosphofructokinase isozyme
  KO
K16370  6-phosphofructokinase 2 [EC:2.7.1.11]
Organism
sbg  Salmonella bongori NCTC 12419
Pathway
sbg00010  Glycolysis / Gluconeogenesis
sbg00030  Pentose phosphate pathway
sbg00051  Fructose and mannose metabolism
sbg00052  Galactose metabolism
sbg00680  Methane metabolism
sbg01100  Metabolic pathways
sbg01110  Biosynthesis of secondary metabolites
sbg01120  Microbial metabolism in diverse environments
sbg01130  Biosynthesis of antibiotics
sbg01200  Carbon metabolism
sbg01230  Biosynthesis of amino acids
Module
sbg_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:sbg00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SBG_1180 (pfkB)
   00030 Pentose phosphate pathway
    SBG_1180 (pfkB)
   00051 Fructose and mannose metabolism
    SBG_1180 (pfkB)
   00052 Galactose metabolism
    SBG_1180 (pfkB)
  Energy metabolism
   00680 Methane metabolism
    SBG_1180 (pfkB)
Enzymes [BR:sbg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     SBG_1180 (pfkB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PfkB Phos_pyr_kin DUF2617
Motif
Other DBs
NCBI-ProteinID: CCC30269
UniProt: A0A0K0H9K7
Position
complement(1292381..1293310)
Genome map
AA seq 309 aa AA seqDB search
MVRIYTLTLAPSLDSATITPQIYPEGKLRCSAPVFEPGGGGINVARAIAHLGGAATAIFP
AGGATGEHLVALLADEHVPVSTVNAKDWTRQNLHVHVESSGEQYRFVMPGATLDDDEFRQ
LEEHVLEIESGAILVISGSLPPGVKVDKLTQLISAAQRQGIRCIIDSSGEALTAALALGG
IELVKPNLKELSALVNRDLTQPDDVRKAAQELVQSGKARRVVVSLGPQGALGVDGENCIQ
VVPPPVKSQSTVGAGDSMVGAMTLKLAEDASLEEMVRFGVAAGSAATLNQGTRLCSHDDT
QKIYAYLSA
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atggtacgtatctatacgttaacgcttgcgccctcactcgatagcgcaacaatcacaccg
caaatttatcccgaaggtaaactgcggtgttccgcgccggtattcgaacccggcggcggc
ggtattaatgtcgctcgcgccattgcgcatcttggcggcgccgcaaccgcaatttttcca
gcgggcggcgcaaccggtgagcatctggttgccttactggccgacgaacatgtcccggtt
tctaccgttaatgcaaaagactggacccgccagaacctgcacgtccatgttgagtccagc
ggcgagcagtatcgttttgtcatgcctggcgccacgcttgacgatgatgaatttcgccaa
cttgaagaacacgtgctggaaattgaatcaggggcaatcctggttatcagcggtagcctt
ccgcctggggttaaggtcgacaagctcacacaattaatttccgctgcgcagagacaaggc
attcgctgcattattgacagctccggcgaagcactcaccgcagccctggcgcttggcggc
atcgaactggtgaaacctaacctgaaagaattgagtgcgttagtcaaccgcgatctgaca
caacctgatgatgtgcgtaaagcagctcaggaattagtacaaagcggcaaagcgcgccgg
gtggtcgtctctttggggcctcagggggcgctgggcgtagatggcgaaaactgcatccag
gtcgttcctcccccggtgaaaagccaaagcaccgtcggcgctggcgacagtatggtaggc
gccatgacattaaaattggcggaagacgcgtcgctggaggagatggtgcgctttggcgta
gcagcgggtagcgccgccacgctcaatcagggtacgcgtctgtgctctcacgatgatacc
caaaaaatatacgcttatctttccgcataa

DBGET integrated database retrieval system