KEGG   Salmonella bongori NCTC 12419: SBG_1235Help
Entry
SBG_1235          CDS       T01579                                 

Definition
(GenBank) type VI secretion protein (DotU)
  KO
K11892  type VI secretion system protein ImpK
Organism
sbg  Salmonella bongori NCTC 12419
Pathway
sbg03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:sbg00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    SBG_1235
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:sbg02044]
    SBG_1235
Secretion system [BR:sbg02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   SBG_1235
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DotU CLASP_N
Motif
Other DBs
NCBI-ProteinID: CCC30323
UniProt: A0A0K0HAC9
Position
complement(1354744..1355490)
Genome map
AA seq 248 aa AA seqDB search
MPVNPDMPACRLFDDIFSRWLTQFEQWKRITLPPEALHQLAFDYSNQTVADYSRRLTREL
GTPFKQHIDAAIYALVALLDETVLYSDWPALSWWQDCPLEYHLWQTHSAGDQFPAHIQAL
LNERNPAQRDLAALYLRCLTLGFGVKRDNFDEQAHQETCRLLWHFAFQEEAQMSGIAQKL
NADSLASPLQLPPRRRLPDNSRLHLIAFIVLLTLLLLSQRLWLSIEDAIGVSTLPNFPVT
QYCEGDRS
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgcctgttaatccagatatgcccgcctgccggttatttgacgacattttttcccgctgg
ctgacccaatttgagcaatggaagcgcatcaccctgcctcctgaagcgctgcaccagtta
gctttcgactacagtaatcagactgtcgccgattatagccgacgcctgacccgtgaactg
ggcacgccctttaagcagcatattgatgccgcgatttatgcgctggtagcgctgctcgat
gaaaccgttctttatagcgactggcctgcacttagctggtggcaggactgcccgctggaa
taccatctctggcaaactcacagcgctggcgaccagtttcccgctcatattcaggcactg
ctgaatgaacgcaaccctgcgcaacgcgatctggcggccctttatctgcgctgcctgacg
ctgggctttggtgtcaaacgtgacaacttcgacgaacaagcccatcaggagacctgccgt
ttgctatggcattttgcttttcaggaagaggcgcaaatgtcgggcatcgcgcaaaagctc
aatgccgactcgctggcgtcgcctttgcagcttcctccccgccgccgccttccggacaat
tcccgtctgcatctgatcgccttcattgtgctactgacgctgttgttactaagccaacgg
ctgtggctgagtattgaagatgccattggcgtcagcactctgcccaactttccagtgacg
cagtattgcgagggagatagatcgtga

DBGET integrated database retrieval system