KEGG   Salmonella bongori NCTC 12419: SBG_1350Help
Entry
SBG_1350          CDS       T01579                                 

Definition
(GenBank) putative aldehyde-dehydrogenase
  KO
K08324  succinate-semialdehyde dehydrogenase [EC:1.2.1.16 1.2.1.24]
Organism
sbg  Salmonella bongori NCTC 12419
Pathway
sbg00250  Alanine, aspartate and glutamate metabolism
sbg00650  Butanoate metabolism
sbg00760  Nicotinate and nicotinamide metabolism
sbg01100  Metabolic pathways
sbg01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sbg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    SBG_1350
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SBG_1350
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    SBG_1350
Enzymes [BR:sbg01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.16  succinate-semialdehyde dehydrogenase [NAD(P)+]
     SBG_1350
    1.2.1.24  succinate-semialdehyde dehydrogenase (NAD+)
     SBG_1350
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh Wtap
Motif
Other DBs
NCBI-ProteinID: CCC30439
UniProt: A0A0K0HAP2
Position
1476923..1478311
Genome map
AA seq 462 aa AA seqDB search
MTILTPTQALSIDPATGQTISTMSWSTPQEIEQALNLAANDFNTWKMLPVAQRAQKLRDI
GQALRVHAEEMAQCITREMGKPIKQARAEVTKSAALCDWYAEHGPAMLNSEPTLVENQQA
VIEYRPLGVILAIMPWNFPLWQVLRGAVPILLAGNCYVLKHAPNVTGCAQMIARIFTKAG
IPAGVYGWVNASNEGVSQMINDPRIAAVTVTGSVRAGAAIGAQAGAALKKCVLELGGSDP
FIVLNDADLDLAVKAAVAGRYQNTGQVCAAAKRFIVEEGIAQAFTDRFVAAAAALKTGNP
LIEENDLGPMARFDLRDELHQQVQASVAEGARLLLGGEKIAGEGNYYAVTVLADVTPEMT
AFRQELFGPVAAITVAKDAEHALALANDSDFGLSATVFTNDERLAQEMAARLECGGVFIN
GYSASDARVAFGGVKKSGFGRELSHFGLHEFCNVQTVWKNRV
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atgaccatactgacccccacacaggcgttatccattgatcctgcgaccggacagacgata
tcaacgatgtcctggtccacgccacaagagattgaacaagcgttaaatctggcggccaac
gatttcaacacgtggaaaatgttacccgtcgcgcaacgagcgcaaaaattacgcgatatt
ggccaggcgcttcgcgttcacgcagaagaaatggcgcaatgtattacgcgtgaaatgggg
aaacccatcaaacaggcgcgggcggaagtcaccaaatccgccgcgctatgcgactggtat
gcagaacacggtccggcaatgctgaattctgaacctacgctggtagaaaatcagcaggct
gtcattgaatatcgtccgctgggcgtcattctggcgataatgccatggaattttccttta
tggcaggtattacgtggggcggtaccgatactgttggcggggaattgctatgtgttgaag
cacgcccccaatgtgaccggctgcgcgcagatgatcgcccgaatctttacgaaagccggt
attcctgcgggcgtctatggatgggtgaacgccagtaatgagggcgtgagtcaaatgatt
aacgatccgcgaatcgcagcggtgacggtgaccggcagcgtgcgcgccggtgcggcgatt
ggcgctcaggctggggcggctttgaaaaaatgcgtactggaactgggcgggtccgatccg
tttatcgtgctcaacgatgccgatctcgatttggcagtaaaagccgcggttgcagggcgt
tatcaaaacaccggacaagtttgcgccgccgctaaacgttttatcgtcgaagagggcatt
gcgcaggcatttaccgatcgctttgtcgcggcggccgcggcattaaaaacagggaatcca
ttgatcgaagagaacgatctggggccgatggcgcgcttcgatctgcgtgatgaacttcat
caacaggttcaggcttctgttgctgaaggcgcacggctgttgttaggcggtgagaaaatc
gcaggcgagggcaactattatgccgtaaccgtgctggctgatgtcacacctgagatgaca
gcatttcgtcaggagctttttggccctgtcgccgccattaccgttgcaaaagatgcagag
catgctcttgcgctggcaaatgacagcgattttggcttgtcggcgacagtcttcaccaac
gatgagaggctggctcaggagatggcggcacgtctggagtgcggcggggtatttatcaat
gggtacagcgccagcgatgcgcgtgtggcattcggcggggtgaaaaagagtggtttcggg
cgcgagctttcgcacttcggtttacacgaattttgtaatgtgcagaccgtctggaagaac
cgcgtctaa

DBGET integrated database retrieval system