KEGG   Salmonella bongori NCTC 12419: SBG_1387Help
Entry
SBG_1387          CDS       T01579                                 

Gene name
adhP
Definition
(GenBank) alcohol dehydrogenase
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
sbg  Salmonella bongori NCTC 12419
Pathway
sbg00010  Glycolysis / Gluconeogenesis
sbg00071  Fatty acid degradation
sbg00350  Tyrosine metabolism
sbg00625  Chloroalkane and chloroalkene degradation
sbg00626  Naphthalene degradation
sbg01100  Metabolic pathways
sbg01110  Biosynthesis of secondary metabolites
sbg01120  Microbial metabolism in diverse environments
sbg01130  Biosynthesis of antibiotics
sbg01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:sbg00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SBG_1387 (adhP)
  Lipid metabolism
   00071 Fatty acid degradation
    SBG_1387 (adhP)
  Amino acid metabolism
   00350 Tyrosine metabolism
    SBG_1387 (adhP)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SBG_1387 (adhP)
   00626 Naphthalene degradation
    SBG_1387 (adhP)
Enzymes [BR:sbg01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     SBG_1387 (adhP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 CoA_binding Methyltransf_25 SCP2 2-Hacid_dh_C
Motif
Other DBs
NCBI-ProteinID: CCC30476
UniProt: A0A0K0HA61
Position
1521787..1522797
Genome map
AA seq 336 aa AA seqDB search
MKAAVVTQDHQVDVTEKTLRPLRHGEALLKMECCGVCHTDLHVKNGDFGDKTGVILGHEG
IGVVAEVGPGVASLKPGDRASVAWFFEGCGHCEYCNTGNETLCRNVKNAGYTVDGGMAEE
CIVVADYAVKVPDGLDSAAASSITCAGVTTYKAVKVSHIKPGQWIAIYGLGGLGNLALQY
AKNVFNAKVIAIDVNDGQLKLAEEMGADLTINSRTEDAAKMVQEKTGGAHAAVVTAVAKA
AFNSAVDAVRAGGRVVAVGLPPEAMNLDIPRLVLDGIQVVGSLVGTRQDLTEAFQFAAEG
KVVPKVALRPLEDINAIFKEMEQGQIRGRMVIDFRR
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgaaagctgctgttgtcacacaagatcatcaggttgatgttactgagaaaacgctgcgt
ccccttcgccacggtgaagccttgctgaaaatggagtgctgtggcgtatgccataccgat
ctccacgtaaaaaacggagatttcggtgacaaaactggtgtcattcttggacatgaaggt
attggcgtcgttgctgaggtcgggcccggcgtagcttcgctaaagccaggcgaccgtgcg
agcgttgcgtggttttttgaaggatgcgggcactgtgagtattgcaatacgggtaatgaa
actctgtgccgtaacgtaaaaaatgccggatacacggtggacggcggcatggccgaagag
tgtattgtggtcgcggattatgcggtgaaggtgccggatggtctggattctgcggcggca
agcagtattacctgcgcgggcgttactacctataaagcggtaaaagtttcacatattaaa
cctggccagtggatagccatttatggtctgggcggtcttggtaatctggcattgcaatac
gcgaaaaatgtctttaatgctaaagtgatcgccattgatgttaatgatggacagcttaaa
ctggccgaagaaatgggcgcggacctgaccattaattcacgtacagaagacgcagcgaaa
atggtgcaggaaaaaaccggcggcgcacatgcggctgtcgtcaccgcagtcgctaaggcg
gcgtttaattccgcagtagatgccgttcgcgccggaggccgcgtagtggcagtcggcctg
ccgccagaagccatgaaccttgatatccctcgtctggtactggatgggattcaggttgtc
ggttcgctggtaggtacacgtcaggatcttactgaagccttccagttcgcagcggaagga
aaagtcgtgccgaaagttgctttgcgtccgcttgaagatatcaacgctatttttaaagag
atggaacagggacaaatccgtggccgtatggtcatcgacttccgtcgttaa

DBGET integrated database retrieval system