KEGG   Salmonella bongori NCTC 12419: SBG_2624Help
Entry
SBG_2624          CDS       T01579                                 

Gene name
yqeF
Definition
(GenBank) putative acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
sbg  Salmonella bongori NCTC 12419
Pathway
sbg00071  Fatty acid degradation
sbg00280  Valine, leucine and isoleucine degradation
sbg00310  Lysine degradation
sbg00362  Benzoate degradation
sbg00380  Tryptophan metabolism
sbg00620  Pyruvate metabolism
sbg00630  Glyoxylate and dicarboxylate metabolism
sbg00640  Propanoate metabolism
sbg00650  Butanoate metabolism
sbg00900  Terpenoid backbone biosynthesis
sbg01100  Metabolic pathways
sbg01110  Biosynthesis of secondary metabolites
sbg01120  Microbial metabolism in diverse environments
sbg01130  Biosynthesis of antibiotics
sbg01200  Carbon metabolism
sbg01212  Fatty acid metabolism
sbg02020  Two-component system
Brite
KEGG Orthology (KO) [BR:sbg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SBG_2624 (yqeF)
   00630 Glyoxylate and dicarboxylate metabolism
    SBG_2624 (yqeF)
   00640 Propanoate metabolism
    SBG_2624 (yqeF)
   00650 Butanoate metabolism
    SBG_2624 (yqeF)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SBG_2624 (yqeF)
   00072 Synthesis and degradation of ketone bodies
    SBG_2624 (yqeF)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SBG_2624 (yqeF)
   00310 Lysine degradation
    SBG_2624 (yqeF)
   00380 Tryptophan metabolism
    SBG_2624 (yqeF)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SBG_2624 (yqeF)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SBG_2624 (yqeF)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    SBG_2624 (yqeF)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sbg04147]
    SBG_2624 (yqeF)
Enzymes [BR:sbg01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     SBG_2624 (yqeF)
Exosome [BR:sbg04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SBG_2624 (yqeF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: CCC31675
UniProt: A0A0K0HDH4
Position
complement(2884317..2885495)
Genome map
AA seq 392 aa AA seqDB search
MKEVVIVAALRTPIGCFQGTLARHSAVELGSMVVKALIERSGVDVNAIDEVILGQVLTAG
AGQNPARQSAIKGGLPNTVSAITINDVCGSGLKALHLATQAIQCGEADIVIAGGQENMSR
APHVLNDSRTGALPDADNLVDSLVHDGLWDAFNDYHIGVTAENLAREYGISRELQDAWAL
SSQQKARAAIDTGRFKDEIVPVITQRNGQIAIVDTDEQPRADTSAEGLAQLHPAFDSFGS
VTAGNASSINDGAAAVMMMSEAKAMELGLPILARIRAFASVGVDPALMGIAPVYATRRCL
ERAGWQLADVDLIEANEAFAAQAISVGKMLEWDERRVNVNGGAIALGHPIGASGCRILVS
LVHEMVKRDARKGLATLCIGGGQGVALTVERD
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaggttgtgattgtggcggcactgcggacgcccatcggctgttttcagggaacg
ctggcccgtcattccgccgtcgagctggggagcatggtcgtaaaagcgttgattgagcgc
agtggcgtggatgttaatgctatcgatgaggtcatccttggtcaggtgctgaccgccggc
gccgggcagaacccggcacgccagtccgctatcaagggggggctgcctaataccgtttcc
gctattaccattaatgacgtttgtggttccggtttaaaagcattgcaccttgcgacgcag
gctattcagtgcggtgaggcagacattgttatcgcgggtgggcaggaaaatatgagccgt
gcgccgcatgtcctcaatgacagccgtactggcgcgctacctgatgctgacaatctggtg
gatagcctggtacatgacggcttatgggacgcttttaacgattatcacattggcgtaacg
gcagaaaatctggcgcgggaatatggtatcagccgtgaattacaggatgcctgggcgctc
agttcgcagcaaaaggccagggcggcgatcgataccggacgttttaaagatgagattgtc
cctgtcatcacgcagcgtaacgggcagatcgcgattgtcgataccgatgaacaaccgcgc
gctgacaccagtgcggaagggttagctcaattgcatccggcatttgatagttttggttcg
gtaacggcgggtaatgcctcatcaattaatgacggcgccgccgccgtgatgatgatgagc
gaggcgaaagccatggaattggggttaccgatactggcgcgcatccgcgcgtttgccagt
gtcggcgtcgatccggcgctgatgggtattgctccggtatatgccacccggcgttgcctg
gagcgggcaggatggcaactggcggatgttgatcttattgaagccaacgaagcgtttgcc
gcccaggcgatatcggtcggaaaaatgctggaatgggatgagcgacgggtgaatgttaac
ggtggtgcaatagccttggggcatcccattggtgcttccggttgccgaattcttgtttca
ctggtgcatgaaatggttaaacgcgatgcgcgaaaagggctggcaacgctttgtatcggc
ggtggtcagggcgtcgctttaacggttgagcgtgactga

DBGET integrated database retrieval system