KEGG   Salmonella bongori NCTC 12419: SBG_3311Help
Entry
SBG_3311          CDS       T01579                                 

Gene name
dfp
Definition
(GenBank) conserved hypothetical protein
  KO
K13038  phosphopantothenoylcysteine decarboxylase / phosphopantothenate---cysteine ligase [EC:4.1.1.36 6.3.2.5]
Organism
sbg  Salmonella bongori NCTC 12419
Pathway
sbg00770  Pantothenate and CoA biosynthesis
sbg01100  Metabolic pathways
Module
sbg_M00120  Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:sbg00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    SBG_3311 (dfp)
Enzymes [BR:sbg01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.36  phosphopantothenoylcysteine decarboxylase
     SBG_3311 (dfp)
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.5  phosphopantothenate---cysteine ligase (CTP)
     SBG_3311 (dfp)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DFP Flavoprotein PALP DUF4567
Motif
Other DBs
NCBI-ProteinID: CCC32362
UniProt: A0A0K0HG56
Position
3633216..3634580
Genome map
AA seq 454 aa AA seqDB search
MAQPLEEIDAAVLFLRSASQSGSQAEARRRRDCDKMAALRSHLTGKIIMSLVGKKIVLGV
SGGIAAYKTPELVRRLRERGADVRVAMTEAAKAFITPLSLQAVSGYPVSDSLLDPAAEAA
MGHIELGKWADLVILAPATADLIARVAAGMANDLVSTICLATPAPVAVLPAMNQQMYRAS
ATQHNLDVLASRGLLIWGPDSGSQACGDVGPGRMLDPLVIVDQVATHFAAANDLQHLNIM
ITAGPTREPLDPVRYISNHSSGKMGFAIAAAAARRGANVTLVSGPVSLSTPPFVQRIDVM
TALDMEAAVQSAVQQQHIFIGCAAVADYRAETIASEKIKKQATQGDELTVKMVKNPDIIA
GVAALSDHRPYVVGFAAETNNVEEYARQKRIRKNLDLICANDVSLSNQGFNSDNNALHLF
WQDGDKVLPLERKELLGQLLLDEIVTRYDEKNRR
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
gtggcacagcctttggaggagatcgacgccgccgttttgttcttgcgtagcgcctcgcaa
agtggatcacaggcagaggcacgacgccgtcgagattgtgataaaatggccgccctccga
agccacctaacaggaaagatcataatgagcctggtcggtaagaaaattgttctcggcgtc
agcggcggtattgctgcgtacaaaacaccggaactggtgcgccgtttacgtgagcgcggc
gctgacgtacgcgtggcaatgaccgaggcggcaaaagcctttattacccccctgagctta
caggccgtctcgggctatcccgtgtcagacagcctactggaccctgccgctgaagccgca
atggggcatattgagttgggaaaatgggccgacctggttattctcgcgcccgcaacagcg
gatctaatcgcccgcgtagcagctggtatggccaatgatttagtctctaccatctgcctg
gcgacgccagctccggttgccgttcttccggccatgaatcaacaaatgtatcgcgcctct
gccacacagcataacctggacgtacttgcctctcgcggcctgttaatttggggaccggat
agcggcagccaggcgtgcggcgatgtaggtccgggccgtatgctggacccactggttatc
gtcgatcaggtcgctacacatttcgctgccgccaacgatttgcaacatcttaatatcatg
attacagcaggcccgacacgcgaaccgctcgacccggtgcgttatatttccaaccacagc
tccggtaaaatgggctttgctattgcggcggcggcggcgcggcgtggcgcaaacgtcacg
ctggtctccggtccggtttcgttatcaacaccgccttttgtacaacgcattgatgtcatg
accgcgctggacatggaagctgcggttcaatctgctgttcagcaacagcatattttcatt
ggttgcgccgccgtagctgactatcgcgcagaaactatcgccagtgaaaaaatcaaaaag
caggcgacgcagggtgatgaattaacagtaaaaatggttaaaaatccggacatcatcgcc
ggggtggccgcactcagcgaccatcgaccctatgttgttgggtttgccgcggaaacaaat
aatgtggaagaatacgcccggcaaaaacgtatccgcaagaaccttgacttgatctgtgca
aatgacgtttcactttcaaatcaagggtttaacagcgataacaacgcattacatcttttc
tggcaggatggagataaagtcttaccgcttgagcgaaaagaactcctgggccaattatta
ctcgacgagatcgtgacccgttatgatgaaaaaaatcgacgttaa

DBGET integrated database retrieval system