KEGG   Salmonella bongori NCTC 12419: SBG_3739Help
Entry
SBG_3739          CDS       T01579                                 

Gene name
melA
Definition
(GenBank) alpha-galactosidase
  KO
K07406  alpha-galactosidase [EC:3.2.1.22]
Organism
sbg  Salmonella bongori NCTC 12419
Pathway
sbg00052  Galactose metabolism
sbg00561  Glycerolipid metabolism
sbg00600  Sphingolipid metabolism
sbg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sbg00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    SBG_3739 (melA)
  Lipid metabolism
   00561 Glycerolipid metabolism
    SBG_3739 (melA)
   00600 Sphingolipid metabolism
    SBG_3739 (melA)
Enzymes [BR:sbg01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     SBG_3739 (melA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_4 Glyco_hydro_4C
Motif
Other DBs
NCBI-ProteinID: CCC32784
UniProt: A0A0K0HGN6
Position
4165157..4166509
Genome map
AA seq 450 aa AA seqDB search
MTAPKITFIGAGSTIFVKNILGDVFHRPALKSAHIALMDIDETRLEESHIVVRKLMDSAG
ASGRITCHTNQKAALQDADFVVVAFQIGGYEPCTVTDFEVCKRHGLEQTIADTLGPGGIM
RALRTIPHLWQICEDMTEVCPKATMLNYVNPMAMNTWAMYARYPLIKQVGLCHSVQGTAE
ELARDLSIDPISLRYRCAGINHMAFYLQLERKTADGTYVDLYPELLAAYNAGQAPKPNIH
GNERCQNIVRYEMFKKLGYFVTESSEHFAEYTPWFIKPGREDLIARYKVPLDEYPKRCVE
QLANWHKELEEYKTAERIEIKPSREYASTIMNAIWTGEPSVIYGNVRNDGLIDNLPQGCC
VEVACLVDANGIQPTKVGTIPSHLAAMMQTNINVQALLTEAILTENRDRVYHAAMMDPHT
AAVLGIEEIYALVDDLIAAHGDWLPAWLHH
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
atgacggcacccaaaatcacttttattggcgcaggttctacgatttttgtcaaaaatatt
ctcggcgatgtgtttcaccgcccggcgctgaagtcggcgcatatcgccctgatggatatt
gacgaaacccgacttgaagagtcgcatattgtggtgcgaaaactgatggactcggcgggc
gcgtctggccggattacttgccataccaaccagaaagcggcgttacaggatgccgatttc
gtggtggtcgccttccagattggcggctatgaaccctgtacggtgaccgattttgaggtt
tgtaaacgtcatggtctggagcagacgattgccgatacactgggcccgggtggcattatg
cgcgcgctgcgtactattccgcatctgtggcagatctgcgaagacatgacggaagtctgc
ccgaaggctaccatgcttaattacgtcaatccgatggcgatgaatacctgggcgatgtat
gcccgttacccacttatcaaacaggttggcctgtgccactcggtacagggaacggcagaa
gaactggcgcgcgatctgagtatcgatcccatctcgctgcgctaccgctgcgccggaatt
aaccatatggcgttttacctgcaactggagcgcaaaacggctgacgggacctacgttgat
ctttatccggaactgctggcggcatacaacgccgggcaggcgccaaagccaaatattcac
ggcaatgaacgctgccagaatattgtccgctatgagatgttcaaaaaactgggctacttt
gtcaccgagtcttccgagcattttgctgagtacacgccgtggtttatcaaaccgggacgt
gaagacctgattgcgcgatacaaggtcccgctggatgaatatcccaaacgttgtgttgag
cagttagcgaactggcacaaggagcttgaggagtacaaaacggcggaacgtattgagatt
aaaccgtcgcgggaatatgccagcactatcatgaatgcgatctggaccggcgaaccgagc
gtaatttatggcaacgtacgcaatgacggtcttattgataacctgccacaagggtgctgc
gtggaggttgcctgcctggtcgatgcaaatggtatccagccgacgaaagtggggacgatc
ccgtcgcatctggcggcgatgatgcagaccaatatcaacgttcaggctcttctaacggaa
gccattctgacggaaaaccgtgaccgcgtttaccatgcggccatgatggatccgcacacc
gccgcggtactgggcattgaggaaatttacgcgctggtggatgacctgatcgccgcacac
ggcgactggctaccggcctggttacatcattaa

DBGET integrated database retrieval system