KEGG   Streptomyces bingchenggensis: SBI_00459Help
Entry
SBI_00459         CDS       T01678                                 

Definition
(GenBank) methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
sbh  Streptomyces bingchenggensis
Pathway
sbh00450  Selenocompound metabolism
sbh00970  Aminoacyl-tRNA biosynthesis
sbh01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sbh00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    SBI_00459
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    SBI_00459
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:sbh01007]
    SBI_00459
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:sbh03016]
    SBI_00459
Enzymes [BR:sbh01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     SBI_00459
Amino acid related enzymes [BR:sbh01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   SBI_00459
Transfer RNA biogenesis [BR:sbh03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    SBI_00459
 Prokaryotic type
   Other AARSs
    SBI_00459
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1
Motif
Other DBs
NCBI-ProteinID: ADI03580
UniProt: D7C089
Position
complement(534067..535590)
Genome map
AA seq 507 aa AA seqDB search
MTAPRRYITTTIPYVNARPHLGFALELVQADTLARHHRRRGEQVRLLSGTDDNSLKNVLA
AEAAGTDVQSFVDRNADAFAALRGPLALSFDDFIRTSSDPRHRVGVERLWRRCAASGDLY
RREYEGLYCVGCEQFYTPDELVDGRCGEHGTEPQLVTEENWFFRLSRYAGRLHQLISSGD
LRIEPVARRNEVLALVEGGLHDFSVSRSHSRARGWGIPVPEDPSQVVYVWWDALGNYVTS
LGYGTDDTAYDQWWATSERRVHLVGKGVVRFHAVYWPAMLLSAGLPLPTDILVHDYLTVD
GRKISKSAGTTVDPAALAAAHGTDAVRWWLLRDVPRIGDADFTPDRLTGRADADFAGGLG
NLIHRIVTMVHRFRGGTVPVSAPSSGLALVDVCRKVPGLVDAALADFDFRRAIRAVWNIV
EEANRCIDATRPWELARAERQGDGEAAKRLDTVLVTLVTACRVLADELRSFIPDAATRIA
AQLTPVEGRLPAAQPLFPRLQEDTRLV
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcaccacgccgctacatcaccacgaccattccgtacgtcaacgcgcgcccgcac
ctgggtttcgctctggaactcgtccaagcggacacgttggcccgtcaccaccgcaggcga
ggtgagcaggtccggctgctcagcggaaccgacgacaactctctgaagaacgtcctggcc
gccgaagcggccggcaccgatgtgcagtcgttcgtcgaccgcaacgccgacgcgttcgcc
gcattgcgcggtccactggcgctctcgttcgacgacttcatccgcaccagcagcgacccg
cgccaccgcgtcggggtcgaacggctgtggcgccggtgcgccgcgtcgggcgacctctat
cgcagagagtacgagggcctgtactgcgtgggctgcgagcagttctacacccctgacgaa
ctggtcgatggacggtgtggcgaacacggcaccgaacctcagctcgtcacggaagagaac
tggttcttccggctgtcacgctacgccggccgcctccatcagctgatctccagcggcgac
ctgcgtatcgagcccgtcgcccgccgcaacgaggtcctggcccttgtcgaaggcggtctg
cacgacttctccgtctcccgctcccacagccgcgcccgcggctggggcatccccgtgccc
gaagacccgagccaggtcgtctatgtgtggtgggacgcccttggcaactacgtcaccagc
cttggctacggcaccgatgacaccgcctacgaccagtggtgggccaccagcgagcgccgt
gtccacctggtcggcaagggagtggtgcgcttccacgccgtgtactggcctgccatgctg
ctgtcggccggactcccgctgcccaccgacatcctggtccacgactacctcaccgtcgac
ggccgcaagatcagcaaatccgccggaaccaccgtcgacccggccgcactggccgcggcc
catggcaccgacgcggtgcgctggtggcttctgcgcgatgtgccccggatcggggacgcc
gacttcactcccgaccgcctgaccggccgcgcggatgcggatttcgccgggggactgggc
aacctcatccatcgcatcgtgacaatggttcaccgctttcgcggcggaaccgttcccgtc
tcggccccttccagtgggttggcgctggtggacgtctgccggaaggtgcccggtctcgtc
gacgccgccttggccgacttcgacttccggcgtgccatccgcgctgtctggaacatcgtg
gaggaagccaaccggtgtattgatgccactcggccatgggaactggctcgggcagagcgg
cagggcgacggtgaagctgcgaagcggctcgacaccgttctcgtcacgctggtcaccgca
tgccgcgtactggcggatgaactacgttccttcatccccgatgccgccacgcggatcgcc
gcacagctgacaccggtcgaggggcgtctgcccgcagcacagccgcttttcccccgcctt
caggaggacacgcggctggtgtga

DBGET integrated database retrieval system