KEGG   Streptomyces bingchenggensis: SBI_01932Help
Entry
SBI_01932         CDS       T01678                                 

Gene name
gnd3
Definition
(GenBank) 6-phosphogluconate dehydrogenase
  KO
K00033  6-phosphogluconate dehydrogenase [EC:1.1.1.44 1.1.1.343]
Organism
sbh  Streptomyces bingchenggensis
Pathway
sbh00030  Pentose phosphate pathway
sbh00480  Glutathione metabolism
sbh01100  Metabolic pathways
sbh01110  Biosynthesis of secondary metabolites
sbh01120  Microbial metabolism in diverse environments
sbh01130  Biosynthesis of antibiotics
sbh01200  Carbon metabolism
Module
sbh_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
sbh_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:sbh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    SBI_01932 (gnd3)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    SBI_01932 (gnd3)
Enzymes [BR:sbh01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.44  phosphogluconate dehydrogenase (NADP+-dependent, decarboxylating)
     SBI_01932 (gnd3)
    1.1.1.343  phosphogluconate dehydrogenase (NAD+-dependent, decarboxylating)
     SBI_01932 (gnd3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 6PGD NAD_binding_2 Shikimate_DH 3HCDH_N F420_oxidored 2-Hacid_dh_C ApbA NAD_binding_11
Motif
Other DBs
NCBI-ProteinID: ADI05053
UniProt: D7BQ46
Position
2597863..2599311
Genome map
AA seq 482 aa AA seqDB search
MNTSASLGSLGVTGLGVMGRNLARNFARHGYPVAVHNRTVNRTHALIEEFGHEGTFVPAK
TAEEFVAALERPRRLVIMVQAGAATDAVIDEFAPLLEPGDMIIDGGNAHFSDTRRREAAL
RERGLHFVGAGISGGEEGALNGPSIMVGGSAESYGVLGPMFEAISAKIDGEPCATHIGTD
GAGHFVKMVHNGIEYADMQLIAEAYDLLRQVAGYTPAEIADIFRTWNEGRLGSYLIEITA
EVLAHTDADTGGPFVDVVVDAAGQKGTGRWTVQTALDLASPVTAIAQATFARAASGQAEL
RAAYRGLPGGTTPPLSRSEATRFTGQVEHALYASKVIAYDQGWKMIQDAAAEYGWKIDLG
AVARIWRGGCIIRASFLDRIRAAYAADPELVSLVGEKTFAAEITDAQVPWREIVASAARR
GIPVPAFSTALAYYDTLRADRLPAALLQGQRDFFGAHTYRRTDRPGTFHTHWSHPDRPET
SG
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atgaacacgtctgcttctctcggttctctcggcgtcaccggcctgggagtcatgggccgc
aacctggcccgcaacttcgcccgccacggctaccccgtcgccgtccacaaccgcaccgtg
aaccgcacccatgcgctcatcgaggagttcggccacgagggcaccttcgtcccggccaag
accgcggaggagttcgtggccgctctggagcgcccccgccgtctggtgatcatggtgcaa
gcaggcgcggccaccgacgccgtcatcgacgagttcgccccgctgctggagcccggcgac
atgatcatcgacggaggcaacgcccatttcagcgacacccgccgccgcgaggccgcgctg
cgcgagcgcggtctccacttcgtcggcgccggcatctccggcggcgaggagggcgccctc
aacggtccgtccatcatggtcggcggctcggcggagtcgtacggcgtcctcggcccgatg
ttcgaggccatcagcgcgaagatcgacggcgagccgtgcgcgacccatatcggcaccgac
ggtgccggacacttcgtcaagatggtccacaatggcatcgagtacgccgatatgcagctc
atcgccgaggcgtacgacctgctccgccaggtcgcgggatacaccccggccgagatcgcg
gacatcttccgcacctggaacgagggccggctcggctcttatctgatcgagatcaccgcc
gaagtcctcgcccacaccgacgccgacaccggcggccccttcgtcgacgtcgtcgtcgac
gccgcgggccagaagggcaccggccgctggaccgtgcagaccgcccttgacctggcctcc
ccggtcaccgccatcgcccaggccaccttcgcccgcgccgcctccggccaggccgagctg
cgcgccgcctaccgcggtctgcccggcggcaccacgccgccgctcagccgctccgaggcc
acgcggttcaccggacaggtcgagcacgccctgtacgcctccaaggtcatcgcgtacgac
cagggctggaagatgatccaggacgcggcggccgagtacggctggaagatcgacctcgga
gcggtcgcccggatctggcgtggcggttgcatcatccgcgcctccttcctggaccgcatc
cgcgccgcgtacgccgccgatccggagctggtcagcctggtcggcgagaagaccttcgcc
gcggagatcacggacgcccaggtgccctggcgcgagatcgtggcctccgccgcgcgccgt
ggcatccccgtccccgccttctccacggccctcgcctactacgacaccctgcgcgcggac
cgcctgcccgccgcgctcctccagggccagcgcgacttcttcggcgcccacacctatcgg
cgcaccgaccgccccggcaccttccacacccactggtcccaccccgaccgcccggagacg
agcggctga

DBGET integrated database retrieval system