KEGG   Streptomyces bingchenggensis: SBI_02021Help
Entry
SBI_02021         CDS       T01678                                 

Definition
(GenBank) sugar kinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
sbh  Streptomyces bingchenggensis
Pathway
sbh00010  Glycolysis / Gluconeogenesis
sbh00052  Galactose metabolism
sbh00500  Starch and sucrose metabolism
sbh00520  Amino sugar and nucleotide sugar metabolism
sbh00521  Streptomycin biosynthesis
sbh01100  Metabolic pathways
sbh01110  Biosynthesis of secondary metabolites
sbh01120  Microbial metabolism in diverse environments
sbh01130  Biosynthesis of antibiotics
sbh01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sbh00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SBI_02021
   00052 Galactose metabolism
    SBI_02021
   00500 Starch and sucrose metabolism
    SBI_02021
   00520 Amino sugar and nucleotide sugar metabolism
    SBI_02021
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    SBI_02021
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    SBI_02021
Enzymes [BR:sbh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     SBI_02021
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK DUF4445
Motif
Other DBs
NCBI-ProteinID: ADI05142
UniProt: D7BRH9
Position
complement(2777803..2778771)
Genome map
AA seq 322 aa AA seqDB search
MPRDLIAALDIGGTKIAGALVDGSGKLVARARRATPAQEPGETVMREVTAVLDELSGSAQ
WSRVAAVGIGSAGPVDASVGTVSPVNIPGWRDFPLVAGVRETVGELPLALVGDGVAMTAA
EHWQGAARGRTGALCMVVSTGVGGGLVLNGRLHPGPTGNAGHIGHISVDLDGDPCPCGAR
GCVERIASGPNIARRALEGGWRPGPGGDTSAAAVAASARTGDPVARASFERAAQALAAGI
AATATLVEIEVAVVGGGVAGAGDVLFAPLRRALRDYATLSFVSGLEVVPAQMGTDAGLVG
AAAAAAQQAGLDGFGTPSRELG
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgccacgtgacctcattgccgcactggatatcggcggtaccaagatcgcgggtgccctg
gtggacggcagcggcaaactggtcgcacgggccagacgcgccacccccgcccaggagccg
ggcgagaccgtgatgcgcgaggtcacggcggtgctcgacgagctgtccggcagcgcgcag
tggtcgcgggtcgccgcggtcggaatcggcagcgcgggcccggtcgacgcctccgtcggc
accgtcagccccgtcaacatccccggctggcgcgacttccccctcgtcgccggggtccgg
gagacggtcggcgaactgccgctcgcgctcgtcggcgacggggtggcgatgacggcggcc
gaacactggcagggcgcggcgcgcgggcgtacgggcgcgctgtgcatggtggtgtccacg
ggcgtcggcggcggcctggtactgaacggccgactgcacccgggccccacggggaacgcc
gggcacatcggccacatcagcgtcgacctcgacggcgacccgtgcccgtgcggtgcgcgc
ggctgcgtcgagcgcatcgccagcggacccaacatcgcccgccgcgccctggaaggcggc
tggcgccccggcccgggcggcgatacgagcgcggcggccgtggcggcctcggcccggacc
ggcgacccggtcgcgcgggcctccttcgaacgcgccgcgcaggcgctggccgccgggatc
gcggccaccgcgacgctcgtcgagatcgaggtggccgtggtcggcggcggggtggcgggc
gccggggacgtgctcttcgcacccctgcggcgcgcgctgcgcgactacgcgaccctgtcg
ttcgtcagcggcctggaggtcgtccccgcgcagatgggcacggacgccggcctggtcggc
gccgccgcggcggcggcccaacaggccggactggatggcttcggaaccccttcccgggag
ctgggctag

DBGET integrated database retrieval system