KEGG   Streptomyces bingchenggensis: SBI_02328Help
Entry
SBI_02328         CDS       T01678                                 

Gene name
ribA1
Definition
(GenBank) bifunctional 3,4-dihydroxy-2-butanone 4-phosphate synthase/GTP cyclohydrolase II protein
  KO
K14652  3,4-dihydroxy 2-butanone 4-phosphate synthase / GTP cyclohydrolase II [EC:4.1.99.12 3.5.4.25]
Organism
sbh  Streptomyces bingchenggensis
Pathway
sbh00740  Riboflavin metabolism
sbh00790  Folate biosynthesis
sbh01100  Metabolic pathways
sbh01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sbh00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    SBI_02328 (ribA1)
   00790 Folate biosynthesis
    SBI_02328 (ribA1)
Enzymes [BR:sbh01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.25  GTP cyclohydrolase II
     SBI_02328 (ribA1)
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.99  Other carbon-carbon lyases
    4.1.99.12  3,4-dihydroxy-2-butanone-4-phosphate synthase
     SBI_02328 (ribA1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHBP_synthase GTP_cyclohydro2
Motif
Other DBs
NCBI-ProteinID: ADI05449
UniProt: D7BV70
Position
complement(3159096..3160505)
Genome map
AA seq 469 aa AA seqDB search
MTAPVGEPQTPMDSVDSMDSSNTRKRHMTPVQSVQAVQAVPSPQSAPEWPDELSLDSVER
AIAEIAAGRPVVVVDDEDRENEGDLIVAAEKATPEIVAFMMSECRGLICATLDAADLDRL
RLPQMVEENSESMRTAFTVSVDATAEHGVGTGISAADRSTTLRLLADPHSTPEDFARPGH
IFPLRPRDGGVLTRDGHTEAGVDLARLAGLRPAAAICEIAGPDGTMLRLPELVSFARRNG
LAIISIEALIAYRRATEPTVRREAETRLPTAFGDFQAYGYRSTTDGVEHIALVQGDIGDG
EDVLVRIHSECLTGDVFGSQRCDCGPQLHASLERITAEGRGVVVYLRGHEGRGIGLLSKL
RAYELQELGRDTLDANLELGLPADARDYAAGARILADLGVRSLRLMTNNPEKTAALVRHG
LRVTGREPMPVQAGEHNLRYLRTKRDRMGHDLPWLESGRPQPMSACGNQ
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcccccgtcggcgagccccagacacccatggacagcgtggacagcatggacagc
agcaacaccaggaagcgacacatgacccccgtgcagagcgtgcaggccgtgcaggccgtg
ccgagcccgcagagcgcccccgaatggcccgacgagctgtccctcgactccgtcgagcgg
gccatcgccgagatcgccgccgggcgccccgtcgtggtcgtggacgacgaggaccgggag
aacgagggcgacctcatcgtcgccgccgagaaggccacccccgagatcgtcgccttcatg
atgagcgagtgccgcgggctgatctgcgccaccctggacgccgccgacctcgaccggcta
cggctgccgcagatggtcgaggagaactccgagtccatgcgcaccgccttcaccgtctcg
gtcgacgccaccgccgaacacggcgtcggcaccggcatctccgccgccgaccggtccacc
accctgcgcctgctggccgatccgcactccacccccgaggacttcgcgcgccccggccat
atcttcccgctgcgcccccgcgacggcggtgtgctcacccgcgacggccacaccgaagcc
ggcgtcgacctcgcccggctggcggggctgcgcccggccgccgcgatctgcgagatcgcg
ggccccgacggcaccatgctgcgcctgcccgaactggtctccttcgcccgccgcaacggg
ctggcgatcatctccatcgaggccctgatcgcctaccgcagggccaccgagcccaccgtg
cggcgcgaggccgagacccggctgcccaccgccttcggcgacttccaggcgtacggctac
cgctccaccaccgacggcgtcgagcacatcgccctcgtccagggcgacatcggcgacggc
gaggacgtcctggtccgtatccactccgagtgcctgaccggcgatgtcttcggctcgcag
cgctgcgactgcggcccccagctgcacgcctccctggagcggatcaccgccgagggccgc
ggcgtggtggtctatctgcgcggccacgagggccgcggcatcgggctgctgtccaagctg
cgcgcatacgagctgcaggagctgggccgcgacaccctcgacgccaacctcgaactcggc
ctgcccgccgacgcccgcgactacgccgccggcgcccgtatcctcgccgacctcggtgtg
cgctcgctgcgcctgatgaccaacaacccggagaagaccgcggcgctggtccggcacggg
ctgcgggtcaccggccgggagccgatgcccgtccaggccggtgagcacaacctgcgctat
ctgcgcaccaagcgcgaccgtatgggccacgacctgccgtggctggagagcggccgcccc
cagccgatgtccgcctgcggcaaccagtag

DBGET integrated database retrieval system