KEGG   Streptomyces bingchenggensis: SBI_02681Help
Entry
SBI_02681         CDS       T01678                                 

Definition
(GenBank) putative UTP-glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
sbh  Streptomyces bingchenggensis
Pathway
sbh00040  Pentose and glucuronate interconversions
sbh00052  Galactose metabolism
sbh00500  Starch and sucrose metabolism
sbh00520  Amino sugar and nucleotide sugar metabolism
sbh01100  Metabolic pathways
sbh01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:sbh00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    SBI_02681
   00052 Galactose metabolism
    SBI_02681
   00500 Starch and sucrose metabolism
    SBI_02681
   00520 Amino sugar and nucleotide sugar metabolism
    SBI_02681
Enzymes [BR:sbh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     SBI_02681
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 IspD
Motif
Other DBs
NCBI-ProteinID: ADI05802
UniProt: D7C0T0
Position
3538414..3539343
Genome map
AA seq 309 aa AA seqDB search
MSLTIRRAVIPAAGLGSRLLPLTKATPKEMLPVGDKPVIEHTVRELVDSGITDITIVVSG
GKSLIQDHFRPNPALVEQLREDGKTAYADAVEEVAELARRGHITYLDQYGPYGNGTPVLN
AARAFGDEPVLVLWPDDVFVAEVPRAQQLIRAYEQTGCPVLALMPMDPNESQRYGVPIVK
EDLGDGQLRITGLVEKPTPAAAPSSYAAIGGYVVTPGIIDELREQTRRWYEHKTGEVYLT
DAINAYASTRAVYGQVIKGRWYDTGNPADYLVAQMASALAHPEYGPVLRGLVAGLDVDRD
AALRSETNT
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgtccctgacgattcgcagggccgtgatccccgccgccggactcggctcccgtctgctg
cccctgacgaaggcgacaccgaaggagatgctcccggtcggcgacaagccggtcatcgag
cacaccgtgcgcgaactggtggactccggcatcaccgacatcaccatcgtcgtctccggc
ggcaagagccttatccaggaccacttccgccccaaccccgccctcgtcgaacaactccgc
gaagacggcaagacggcctacgcggacgcggtggaggaggtcgcggagctggcccgccgg
ggccacatcacctacctcgaccagtacggcccgtacggcaacggcaccccggtgctgaac
gctgcccgtgccttcggcgacgagccggtgctggtgctgtggcccgacgacgtcttcgtg
gccgaggtcccccgcgcccagcagttgatccgcgcgtatgagcagaccggctgcccggtg
ctggccctcatgccgatggaccccaacgagtcccagcgctatggcgtgcccatcgtcaag
gaagacctcggagatggccaactgcgcatcaccggcctggtcgaaaagcccacgcccgct
gccgccccgtcctcgtacgcggcgatcggcggctatgtcgtcacccctggcatcatcgac
gaactgcgtgagcagacccgccgctggtacgagcacaagaccggcgaggtctacctgacc
gacgccatcaacgcctacgcctccacccgcgcggtgtacgggcaggtcatcaagggccgc
tggtacgacaccggcaacccggccgactacctggtcgcccagatggcgtccgccctcgcc
cacccggagtacggccccgtcctacgcggcctggtcgccggactcgacgtcgaccgcgat
gccgccctccggtcggaaaccaacacctga

DBGET integrated database retrieval system