KEGG   Streptomyces bingchenggensis: SBI_02713Help
Entry
SBI_02713         CDS       T01678                                 

Gene name
sucC
Definition
(GenBank) succinyl-CoA synthetase subunit beta
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
sbh  Streptomyces bingchenggensis
Pathway
sbh00020  Citrate cycle (TCA cycle)
sbh00640  Propanoate metabolism
sbh00660  C5-Branched dibasic acid metabolism
sbh01100  Metabolic pathways
sbh01110  Biosynthesis of secondary metabolites
sbh01120  Microbial metabolism in diverse environments
sbh01130  Biosynthesis of antibiotics
sbh01200  Carbon metabolism
Module
sbh_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sbh_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:sbh00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SBI_02713 (sucC)
   00640 Propanoate metabolism
    SBI_02713 (sucC)
   00660 C5-Branched dibasic acid metabolism
    SBI_02713 (sucC)
Enzymes [BR:sbh01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     SBI_02713 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 ATP-grasp_5 Ligase_CoA GARS_A
Motif
Other DBs
NCBI-ProteinID: ADI05834
UniProt: D7C0W2
Position
complement(3586230..3587357)
Genome map
AA seq 375 aa AA seqDB search
MDLFEHQARELFERYGVLVPRAEVAGSAPAARAAAERLGGRVVVKAQVKTGGRGKAGGVK
LAADPAAAELTARQILGMDIKGHTVHQVMVAEPVEVEREFYVGYTLDRARGRFLAIASAE
GGMEIEEVAARRPEAVARIAVDPEEGVTEAKAAEIAAAGGLPAEAAATLHRLWTVLTEQD
ALLVEVNPLVVTRGGAIVALDGKVTLDDNADFRRTYAYEDTGGAGLEAEAAAKGLNYVKL
DGEVGVIGNGAGLVMSTLDVVAGCGARPADFLDIGGGASAEVMADGLSVVLGDPHVRSVL
VNVFGGITACDAVAEGIVRALDTVTLTKPLVVRLDGNSAARGRAILTERAHPLVHQVDTM
DGAAARAAELAAVAA
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atggacctgttcgaacatcaggcacgggaactcttcgagcgctacggcgtgttggtgcca
cgggcggaggtcgcaggctcggcgcccgcggcccgcgcggcggccgagcggctgggcggc
cgagtcgtcgtcaaggcgcaggtgaagaccgggggacggggcaaggcgggtggggtgaag
ctcgccgccgacccggcggcggccgaattgaccgcccgtcagatcctcggtatggacatc
aaggggcacaccgtccaccaggtgatggtcgccgaaccggtcgaggtggagcgcgagttc
tacgtcggctacaccctggaccgggcccgcggccgcttcctggcgatcgcctccgccgag
ggcggcatggagatcgaggaggtggcggcccgccgccccgaggccgtggcccggatcgcg
gtggaccccgaggagggcgtgaccgaggcgaaggccgccgagatcgccgcggcgggcggg
ctgccggccgaggcggcggcgaccctgcaccggctgtggaccgtgctgaccgagcaggac
gcgctgctggtcgaggtcaacccgctcgtggtgacgcgcggcggggcgatcgtggcgctg
gacggtaaggtgacgctcgacgacaacgcggacttccgacgcacttacgcgtacgaggac
accgggggtgccggtctggaggcggaggcggcggccaagggcctgaactacgtcaaactg
gacggcgaggtcggcgtcatcggcaacggcgcgggcctggtcatgtccaccctcgacgtg
gtcgcgggctgcggcgcccgccccgccgacttcctcgacatcggcggcggcgcctcggcc
gaggtcatggcggacggcctctccgtcgtcctcggcgacccccacgtacggtccgtcctc
gtcaacgtcttcggcgggatcaccgcctgcgacgcggtggccgagggcatcgtccgcgcc
ctggacaccgtcaccctcaccaaaccgctggtcgtccggctcgacggcaacagcgcggcg
cgcggccgggcgatcctcaccgagcgcgcccatccgctcgtacaccaggtggacaccatg
gacggcgccgcggcgcgggccgccgaactcgcggcagtcgcggcctaa

DBGET integrated database retrieval system