KEGG   Streptomyces bingchenggensis: SBI_04351Help
Entry
SBI_04351         CDS       T01678                                 

Gene name
ppc
Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
sbh  Streptomyces bingchenggensis
Pathway
sbh00620  Pyruvate metabolism
sbh00680  Methane metabolism
sbh01100  Metabolic pathways
sbh01120  Microbial metabolism in diverse environments
sbh01200  Carbon metabolism
Module
sbh_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:sbh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SBI_04351 (ppc)
  09102 Energy metabolism
   00680 Methane metabolism
    SBI_04351 (ppc)
Enzymes [BR:sbh01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     SBI_04351 (ppc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase
Motif
Other DBs
NCBI-ProteinID: ADI07471
UniProt: D7BTN2
Position
complement(5473286..5476006)
Genome map
AA seq 906 aa AA seqDB search
MSSADNTNAALRADIRRLGDLLGETLVRQEGPDLLDLVERVRALTRSDGEAAAELLGDTD
LETAAKLVRAFSTYFHLANITEQVHRGRELRAKRAAEGGLLSRTADQLKDADPEHLREAV
RHLNVRPVFTAHPTEAARRTVLNKLRRVAELLDTLAVGGDKRRTDLRLAENIDLLWQTDE
LRVARPEPADEARNAIYYLDELHAGAVGDVLEDLSAELERVGAPLPATTRPLTFGTWIGG
DRDGNPNVTPQVTWDVLILQHEHGITDALAIVDDLRAALSSSIRNSDASEELLDSLQRDL
ELLPEISPRYKRLNAEEPYRLKATCVRQKLLNTRTRLAGGTPHQPGRDYLGTAELLADLH
LIQESLRAHRGRLIADGRMERAIRTLAAFGLQLATMDVREHADAHHHALGQLFDRLGEES
WRYADMPRDSRRKLLAKELRSRRPLAPTPAPLDAAGAKTLGVFHTISEAFERFGPEIVES
YIISMCQGSDDVFAAAVLAREAGLVDLHAGWAKIGIVPLLETTEELKIADQLLDDMLSDP
SYRRLVALRGDVQEVMLGYSDSSKFGGITTSQWEIHRAQRLLRDVAHRHGVRLRLFHGRG
GTVGRGGGPTHDAILAQPWGTLEGEIKVTEQGEVISDKYLVPSLARENLELTVAATLQAS
ALHTAPRQSDEALAGWDAAMDTVSDAAHRAYRALVEDPDLPAYFFASTPVDQLAELHLGS
RPSRRPDSGAGLDGLRAIPWVFGWTQSRQIVPGWFGVGSGLKAAREAGLDPALDEMHQHW
HFFRNFLSNVEMTLAKTDLRIARHYVDTLVPDELKHVFATIEAEHELTVREVLRITGETE
LLDSNPVLKQTFHVRDAYLDPISYLQVSLLHRQRTAHEQGEAPDPLLARALLLTVNGVAA
GLRNTG
NT seq 2721 nt NT seq  +upstreamnt  +downstreamnt
gtgagcagtgccgacaacaccaatgccgccctgcgtgccgatatccgccgtctgggtgac
ctgctcggcgaaaccctggtccggcaggagggccccgacctcctcgacctcgtcgagcgc
gtccgcgccctcacccgcagtgacggcgaagccgccgcggagctgctcggcgacaccgac
ctggagacggcggccaagctcgtacgcgcgttctccacgtacttccatctggcgaacatc
accgaacaggtccaccgcggccgcgagctgcgcgccaagcgcgccgccgagggcgggctg
ctgtcccgcaccgccgaccagctcaaggacgccgaccccgagcatctgcgggaggccgtc
cgccacctgaacgttcgcccggtgttcacggcccaccccaccgaggccgcccgccgcacc
gtcctgaacaagctgcgccgggtcgcggaactgctcgacaccctcgccgtcggcggcgac
aagcgccgcaccgacctgcgcctcgccgagaacatcgacctgctctggcagaccgacgaa
ctgcgcgtcgcccgccccgagccggccgacgaggcccgcaacgccatctactacctggac
gaactgcatgcgggcgccgtcggggacgtcctcgaagacctctccgccgagctggagcgc
gtcggcgccccactgcccgccaccacccgccccctcaccttcggcacctggatcggcggc
gaccgcgacggcaaccccaacgtcaccccccaggtcacctgggacgtgctgatcctccag
cacgaacacggcatcaccgacgccctcgccatcgtcgacgacctgcgcgccgcgctctcc
agctccatccgcaactccgacgcctccgaagagctcctggactccctccagcgcgacctg
gaactcctccccgagatcagcccccgctacaagcggctcaacgccgaagagccctaccgc
ctcaaggccacctgcgtgcggcagaagctgctcaacacccgcacccgcctcgccggcggc
accccccaccagccgggacgcgactacctcggcaccgccgaactcctcgccgacctgcac
ctcatccaggaatccctgcgcgcccaccgcggccggctgatcgccgacggccgcatggag
cgcgccatccgcaccctcgccgccttcgggctccagctggccaccatggacgtacgcgaa
cacgccgacgcccaccaccacgccctcggccagctcttcgaccgcctcggcgaggaatcc
tggcggtacgccgacatgccccgcgactcccgccgcaagctgctcgccaaggagctgcgc
tcccgccgcccgctcgcgcccacccccgcgccgctggacgccgcgggcgccaagaccctc
ggcgtcttccacaccatcagcgaggccttcgaacggttcggccccgagatcgtcgagtcc
tacatcatctccatgtgccagggctccgacgacgtcttcgccgccgccgtcctcgcccgc
gaggccggactggtcgacctgcacgccggctgggccaagatcggcatcgtgccgctgctg
gagaccaccgaagagctaaagatcgccgaccagctcctcgacgacatgctctccgacccc
tcctaccggcggctcgtcgccctgcgcggcgacgtccaggaggtcatgctcggctactcc
gactcgtcgaagttcggcggcatcaccacctcccagtgggagatccaccgcgcccagcgg
ctgctccgcgatgtcgcccaccggcacggcgtacggctgcgcctcttccacggccgcggc
ggcaccgtcggccgcggcggcggccccacccacgacgcgatcctcgcccagccctggggc
accctcgaaggcgagatcaaggtcaccgagcagggcgaggtcatctccgacaagtacctc
gtcccctccctcgcccgggagaacctggagctcaccgtcgccgccacgctccaggcctcc
gccctgcacaccgccccccgccagtccgacgaggccctggccggctgggacgcggccatg
gacaccgtctccgacgccgcccaccgcgcctaccgcgcactggtcgaggaccccgacctc
cccgcgtacttcttcgcctccacccccgtcgaccagctcgccgaactccacctcggctcc
cgcccctcccggcgccccgactccggcgccggcctcgacggactgcgggccatcccgtgg
gtcttcggctggacccagtcccggcagatcgtccccggctggttcggcgtcggctccggg
ctcaaggccgcccgcgaagcgggcctggacccggccctcgacgagatgcaccagcactgg
cacttcttccggaacttcctgtccaacgtggagatgacgctcgccaagaccgatctgcgg
atcgcccggcactacgtcgacacactggtcccggacgagctcaagcacgtcttcgccacc
atcgaagccgagcacgagctcaccgtgcgcgaggtactgcggatcaccggcgagaccgaa
ctcctcgactccaacccggtcctcaagcagaccttccacgtccgcgacgcctacctggac
ccgatctcctacctccaggtctcgctgctgcaccgccagcgcaccgcccacgaacaaggc
gaagcccccgaccccctcctcgcccgcgccctcctcctcacggtcaacggcgtcgcggcg
ggcctgcgcaacacggggtga

DBGET integrated database retrieval system