KEGG   Streptomyces bingchenggensis: SBI_04709Help
Entry
SBI_04709         CDS       T01678                                 

Definition
(GenBank) succinate dehydrogenase hydrophobic membrane anchor protein
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
sbh  Streptomyces bingchenggensis
Pathway
sbh00020  Citrate cycle (TCA cycle)
sbh00190  Oxidative phosphorylation
sbh00650  Butanoate metabolism
sbh01100  Metabolic pathways
sbh01110  Biosynthesis of secondary metabolites
sbh01120  Microbial metabolism in diverse environments
sbh01130  Biosynthesis of antibiotics
sbh01200  Carbon metabolism
Module
sbh_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sbh_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
sbh_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:sbh00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SBI_04709
   00650 Butanoate metabolism
    SBI_04709
  Energy metabolism
   00190 Oxidative phosphorylation
    SBI_04709
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS
Motif
Other DBs
NCBI-ProteinID: ADI07829
UniProt: D7BZ93
Position
5859990..5860460
Genome map
AA seq 156 aa AA seqDB search
MSAETTTPVNDSVHAYDVDHPAPLIEPPRARTRKTPKATRTNFEMYGWLFMRLSGVLLVV
LVLGHLLIQLVLDGGVSKIGFAFVAGRWASPFWQAWDLIMLWLATLHGANGLRTVINDYA
ERDNTRLWLKGLLYTAAGFTIVLGTLVIFTFDPNIR
NT seq 471 nt NT seq  +upstreamnt  +downstreamnt
atgtccgccgagaccaccacccccgtgaacgacagtgtccacgcgtacgacgtggaccac
cccgcgccgctcatcgagccgccgcgcgcccgtacccgcaagacgccgaaggcgacccgc
accaatttcgagatgtacggatggctgttcatgcggctgtccggcgtcctgctggtcgta
ctcgtcctgggccacctgctgatccagctggtcctcgacggcggcgtctccaagatcggc
tttgccttcgtggccggccgctgggcctcgccgttctggcaggcatgggatctgatcatg
ctctggctcgccacgctgcacggcgcgaacggcctgcgcacggtcatcaacgactacgcg
gagcgggacaacacccgcctgtggctgaaggggctgctctacacggcggcaggattcacc
attgtgctcggcactctggtgatcttcaccttcgacccgaacatccgctag

DBGET integrated database retrieval system