KEGG   Streptomyces bingchenggensis: SBI_05003Help
Entry
SBI_05003         CDS       T01678                                 

Gene name
gpmA
Definition
(GenBank) phosphoglyceromutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
sbh  Streptomyces bingchenggensis
Pathway
sbh00010  Glycolysis / Gluconeogenesis
sbh00260  Glycine, serine and threonine metabolism
sbh00680  Methane metabolism
sbh01100  Metabolic pathways
sbh01110  Biosynthesis of secondary metabolites
sbh01120  Microbial metabolism in diverse environments
sbh01130  Biosynthesis of antibiotics
sbh01200  Carbon metabolism
sbh01230  Biosynthesis of amino acids
Module
sbh_M00002  Glycolysis, core module involving three-carbon compounds
sbh_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:sbh00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SBI_05003 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    SBI_05003 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SBI_05003 (gpmA)
Enzymes [BR:sbh01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     SBI_05003 (gpmA)
Membrane trafficking [BR:sbh04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    SBI_05003 (gpmA)
Exosome [BR:sbh04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   SBI_05003 (gpmA)
  Exosomal proteins of melanoma cells
   SBI_05003 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1 DUF4015
Motif
Other DBs
NCBI-ProteinID: ADI08123
UniProt: D7C361
Position
complement(6191200..6191961)
Genome map
AA seq 253 aa AA seqDB search
MADAPYKLILLRHGESEWNAKNLFTGWVDVNLNEKGEKEAVRGGELLKDAGLLPDVVHTS
LQKRAIRTAQLALESADRHWIPVHRSWRLNERHYGALQGKDKAQTLAEFGEEQFMLWRRS
YDTPPPPIDADSEWSQADDPRYATIPPELRPRTECLKDVVARMLPYWYDGIVPDLLAGRT
VLIAAHGNSLRALVKHLDGISDADIAGLNIPTGIPLAYELDADFRPVKPGGTYLDPEAAK
AAIEAVKNQGKKK
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atggccgacgcaccgtacaagctgatcctccttcgccacggcgagagcgagtggaacgcg
aagaacctgttcaccggctgggtggacgtcaacctcaacgagaagggcgagaaggaggca
gtccgcggcggtgagctgctgaaggacgccggcctgctccccgacgtggtccacacgtcc
ctccagaagcgcgccatccgcaccgcgcagctcgccctggagtccgccgaccgccactgg
atcccggtccaccgctcctggcggctcaacgagcgccactacggtgccctccagggcaag
gacaaggcccagaccctcgccgagttcggcgaggagcagttcatgctctggcgccgctcg
tacgacaccccgccgccgcccatcgacgccgactccgagtggtcgcaggccgacgacccg
cgctacgcgaccatcccgccggagctgcggccgcgcaccgaatgcctcaaggacgtcgtc
gcgcgcatgctcccgtactggtacgacggcatcgtcccggacctcctggccggccgcacg
gtcctgatcgccgcccacggcaactcgctgcgcgccctggtcaagcacctcgacggcatc
tccgacgccgacatcgcgggcctcaacatccccaccggcatcccgctcgcctacgagctc
gacgccgacttccgccccgtcaagccgggcggcacctacctcgacccggaggccgcgaag
gcggccatcgaggcggtcaagaaccagggcaagaagaagtaa

DBGET integrated database retrieval system