KEGG   Streptomyces bingchenggensis: SBI_07341Help
Entry
SBI_07341         CDS       T01678                                 

Definition
(GenBank) alpha-galactosidase
  KO
K07407  alpha-galactosidase [EC:3.2.1.22]
Organism
sbh  Streptomyces bingchenggensis
Pathway
sbh00052  Galactose metabolism
sbh00561  Glycerolipid metabolism
sbh00600  Sphingolipid metabolism
sbh01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sbh00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    SBI_07341
  Lipid metabolism
   00561 Glycerolipid metabolism
    SBI_07341
   00600 Sphingolipid metabolism
    SBI_07341
Enzymes [BR:sbh01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     SBI_07341
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Melibiase Glyco_hydro_36N Glyco_hydro_97 TOBE_3
Motif
Other DBs
NCBI-ProteinID: ADI10461
UniProt: D7C7A7
Position
complement(8750353..8752581)
Genome map
AA seq 742 aa AA seqDB search
MTGTASEVASDGAQEAFTWGHARLTAHFATGVDGVVRLVRLTIPDGEGAPPEQPSADQDP
GPGGPHPAPLPLVEVLALGHGSEWSGQRGIETALGARLRHRGHRAVRDGQDERDGQGWHR
LTIDLHDPDTGLTAEVRLSSPDGLPVLRAEVRLTNEGTAPLTVQAVTSLTLGGLPSPDTL
DVHLARNDWLAECRWASEPLRTRIVDLSRDAHQHDSRAALALHSRGGWPSDGHLPMGALT
DRTTGDAWLWQIESPTGWRWETGERAHGTYAALHGPTDAEHQWRERLAPGASFTTVPAAL
ALARGGGLDEALAHLTAYRRATRRPHPDHTTLPVVFNDYMNTLMGDPTTERLLPLIDAAA
EAGAEYFCIDSGWYDDDAQGWWDSVGAWQPSARRFPGGGIQAVLDHIRSRGMVPGLWLEP
EVVGVRSPVAAELPADAFFQRDGIRLVEHGRHHLDLRHPAARAHLDKTIDRIAGEWGVGY
LKLDYNISVAPGTDWHPETGRTAPGAGLLAHARAYQDWLAATLDRHPGLVIENCASGGMR
MDWSSVALTQLQSTSDQQDPLRYPPIAASAPTAVPPEQGAVWAYPQPEFTDDEIDFTLAG
ALLGRIHLSGHLDRMSPRQLARVQWAIAAYRRLRGDLATGVPFWPLGLPGWDDAWVALGV
RSGETAYVTVWRREGGPAECTLPLGHLAGRPAEVEVLHPAAASGAEARWDAGQGELMVTL
PRTPMALLVRLTPADPADQAVF
NT seq 2229 nt NT seq  +upstreamnt  +downstreamnt
ttgaccggtacggcatccgaggtggcgtcagacggcgcccaggaagcgttcacttggggc
cacgcgcggctcacggcccacttcgcgacgggcgtcgacggggtggtgcggctcgtacgg
ctgacgattccggacggcgaaggggcgccccctgagcagccctccgccgaccaggacccc
ggccccggcggcccccaccccgccccgctgccgctcgtcgaagtgctggccctcggccac
ggcagcgagtggtccgggcagcgcggcatcgagaccgcgctcggcgcccggctgcgccac
cggggccaccgggccgtacgggacgggcaggacgagcgcgacggacagggctggcatcgg
ctgacgatcgacctccacgacccggacaccggcctgaccgccgaggtccggctctcctcc
cccgacgggctgccggtgctgcgcgccgaggtccggctcaccaacgagggcaccgccccg
ctgaccgtccaggccgtcaccagcctcaccctcggcgggctcccctcccccgacacgctc
gatgtgcacctggcccgcaacgactggctcgccgaatgccgttgggcgagcgaacccctg
cgcacccggatcgtcgacctcagccgggacgcccaccagcacgacagccgcgccgccctc
gccctccacagccgcggcggctggccgtccgacggccatctgcccatgggcgcgctgacc
gaccgcaccaccggcgacgcatggctgtggcagatcgagtcgccgaccggctggcggtgg
gagaccggggagcgggcccacggtacgtacgccgcgctccacgggccgaccgacgccgag
caccagtggcgcgaacggctcgcccccggcgcgtcgttcaccaccgtccccgccgcgctg
gcgctcgcccggggcggcggcctcgacgaggccctggcccacctcaccgcctaccgccgc
gccacccgccgcccgcaccccgaccacaccaccctgcccgtggtgttcaacgactacatg
aacaccctcatgggcgaccccaccaccgagcgcctgctgccgctgatcgacgccgccgcc
gaggccggggcggagtacttctgcatcgactccggctggtacgacgacgacgcacagggc
tggtgggacagcgtcggcgcctggcagccctcggcccgccgcttccccggcggcggcatc
caggccgtactggaccacatccgctcccgcggcatggtcccggggctgtggctggagccc
gaggtcgtcggcgtacgcagccccgtcgccgccgaactgcccgccgacgccttcttccaa
cgcgacgggatccgcctcgtcgaacacggccgccaccacctcgatctgcgccacccggcc
gcccgcgcccacctcgacaagaccatcgaccgcatcgccggcgaatggggcgtcggctac
ctcaagctcgactacaacatcagcgtggcgccgggcaccgactggcaccccgaaaccggc
cgcaccgcccccggcgcgggcctcctcgcccacgcccgcgcctaccaggactggctggcc
gccacgctcgaccgccaccccgggctcgtcatcgagaactgcgcctcgggcgggatgcgc
atggactggtcctcggtggccctcacccaactccagtccaccagcgaccagcaggacccg
ctccgctacccgcccatcgccgcctcggcgcccacggcggtgccaccggagcagggcgcg
gtatgggcctacccgcagcccgaattcaccgacgacgagatcgacttcactctcgcgggc
gccctgctgggccgcatccacctctccggccacctcgaccggatgtcaccgcggcagctg
gcccgggtgcagtgggccatcgcggcgtaccggcggctgcggggcgatctggccaccggg
gtgccgttctggccgctggggctgccggggtgggacgacgcctgggtggcgctgggggtg
cgcagcggtgagacggcctatgtgacggtatggcgccgggaaggcggcccggcggagtgc
acgctgccgctcgggcacttggcgggccgtccggcggaggtcgaggtgctgcacccggcc
gccgcctcgggcgccgaggctcggtgggacgcggggcagggcgagttgatggtgaccttg
ccgcgtacgccgatggcgctgctggtccggctgacgcccgccgaccccgccgaccaggcc
gtgttttag

DBGET integrated database retrieval system