KEGG   Streptomyces bingchenggensis: SBI_07789Help
Entry
SBI_07789         CDS       T01678                                 

Gene name
sucB
Definition
(GenBank) putative dihydrolipoamide S-succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
sbh  Streptomyces bingchenggensis
Pathway
sbh00020  Citrate cycle (TCA cycle)
sbh00310  Lysine degradation
sbh01100  Metabolic pathways
sbh01110  Biosynthesis of secondary metabolites
sbh01120  Microbial metabolism in diverse environments
sbh01130  Biosynthesis of antibiotics
sbh01200  Carbon metabolism
Module
sbh_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sbh_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:sbh00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SBI_07789 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    SBI_07789 (sucB)
Enzymes [BR:sbh01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     SBI_07789 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 HlyD_3 GCV_H RnfC_N
Motif
Other DBs
NCBI-ProteinID: ADI10909
UniProt: D7CD62
Position
complement(9235819..9237630)
Genome map
AA seq 603 aa AA seqDB search
MAVSVTLPALGESVTEGTVTRWLKAEGERVEADEPLLEVSTDKVDTEIPAPAAGVLTSIK
VAEDETVEVGAELAVIDDGGAAPAAAPAPAAEPAPVAQPEPVPAPVAEAPAPAPAPAAAP
AGAAEGTDVVLPALGESVTEGTVTRWLKEVGDSVEADEPLLEVSTDKVDTEIPAPTSGTL
LEILVAEDETAEVGAKLAVIGAAGAAPAAAPAPAAPPPPAAPAPAAPARAPAAPAPAPAP
VAPAPVAAAPAPAPAPVAPAPVAPAPVAPAPVAPAPVAPAPAAAAPAAAEGEGAYVTPLV
RKLAAENGVDLATVKGTGVGGRIRKQDVIAAAEAAKAAAAAQARAAQAAPAAAPKAAAAA
PSPLRGQTIKMPRMRKVIGDNMMKALHSQAQLTSVVEVDITKLMRLRAQAKEAFAQREGV
KLSPMPFFVKAAVQALKSHPAINARINDDEGTITYFDVENVGIAVDAEKGLMTPVIKNAG
DLSLAGIAKKTAELAGKVRSNKITPDEVSGATFTISNTGSRGALFDTIIVPPNQVAILGI
GATVRRPVVINHPDLGETIAVRDMTYVALSYDHRLVDGADAARYLTAVKEILEAGEFEVE
LGL
NT seq 1812 nt NT seq  +upstreamnt  +downstreamnt
atggcggtttccgtaaccctgccggcgctcggcgagagcgtgaccgagggcaccgtcacc
cgttggcttaaggccgagggtgagcgggtcgaggccgacgagcctctgctcgaggtctcc
accgacaaggtcgacaccgagatcccggcccccgcggccggtgtgctcacctccatcaag
gtggccgaggacgagacggtggaggtcggcgccgagctggccgtcatcgacgacggcggc
gcggccccggccgccgcccccgcccccgcggccgagcccgcccctgtggcgcagcccgag
cccgtcccggcccccgtcgccgaggccccggccccggcgcccgctccggccgccgccccc
gcgggcgcggccgagggcaccgacgtcgtgctgcccgccctgggcgagtcggtgaccgag
ggcacggtcacccgctggctcaaggaggtcggcgactcggtcgaggccgatgagccgctg
ctcgaggtctccaccgacaaggtcgacaccgagattccggctccgacctcgggcaccctg
ctcgagatcctggtcgccgaggacgagaccgctgaggtcggcgccaagctggccgtgatc
ggtgccgcaggcgccgctccggccgccgcacccgcccccgcggccccccccccgcccgcc
gcacccgcccccgcggctcccgccagggcccccgccgctccggcgcctgccccggccccg
gtcgccccggccccggtggccgcggctccggcgcccgccccggctccggtggcgcccgct
ccggtcgccccggccccggtcgccccggccccggtcgctccggcccccgtcgctccggct
ccggccgctgcggctccggctgccgctgagggcgagggtgcgtacgtgaccccgctggtg
cgcaagctcgccgcggagaacggcgtggacctggccaccgtcaagggcaccggcgtcggc
ggccgtatccgcaagcaggacgtcatcgccgccgcggaggccgccaaggccgccgccgcc
gcgcaggcccgggccgcccaggccgccccggccgcggcgccgaaggccgctgccgcggcc
ccgtcgccgctgcgtggccagaccatcaagatgccgcggatgcgcaaggtcatcggcgac
aacatgatgaaggccctgcactcgcaggcgcagctgaccagcgtggtcgaggtggacatc
accaagctcatgcggctgcgggcccaggcgaaggaggcgttcgcacagcgtgagggcgtc
aagctctcgccgatgccgttcttcgtcaaggccgccgtccaggcgctgaagagccacccg
gccatcaacgcccggatcaacgacgacgagggcaccatcacctacttcgacgtcgagaat
gtcggcatcgccgtcgacgcggagaagggcttgatgaccccggtcatcaagaacgcgggt
gacctcagcctcgccggtatcgccaagaagacggcggagctggcgggcaaggtccggtcc
aacaagatcaccccggacgaggtgtccggcgcgaccttcaccatcagcaacaccggttcg
cgcggtgcgctgttcgacacgatcatcgtgccgccgaaccaggtcgccatcctgggcatc
ggcgcgaccgtccgccgcccggtggtcatcaaccacccggacctcggcgagacgatcgcg
gtgcgcgacatgacgtacgtcgcgctctcctacgaccaccgtctggtggacggcgccgac
gccgcccgctacctgacggcggtcaaggagatcctggaggccggcgagttcgaggtcgag
ctcggcctctga

DBGET integrated database retrieval system