KEGG   Streptomyces bingchenggensis: SBI_08779Help
Entry
SBI_08779         CDS       T01678                                 

Definition
(GenBank) putative racemase
  KO
K18334  L-fuconate dehydratase [EC:4.2.1.68]
Organism
sbh  Streptomyces bingchenggensis
Pathway
sbh00051  Fructose and mannose metabolism
sbh01100  Metabolic pathways
sbh01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sbh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    SBI_08779
Enzymes [BR:sbh01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.68  L-fuconate dehydratase
     SBI_08779
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MR_MLE_C MR_MLE_N
Motif
Other DBs
NCBI-ProteinID: ADI11897
UniProt: D7BY17
Position
complement(10406056..10407390)
Genome map
AA seq 444 aa AA seqDB search
MKQLTRARITAVDAYDVRFPTSRRLDGSDAMHPDPDYSAAYVTIRTDAPDGLEGHGFCFT
IGRGNEVAVAAIDALRPHLTGAELDGTLTGLADHYRALTGDSQLRWLGPDKGVTHMAIGA
VLNALWDLHAKRAGKPLWKLLADLTPEELVALTDFRYLADALTPDEALLILRRAEPGKAE
REARLRAEGYPAYAASPGWLGYSDAHLASAARRAVADGFTQIKLKVGADLEDDIRRCRIA
REAVGPDIRIALDANQRWELGEAVEWTRALAGFDPYWIEEPTSPDEILGLAAIRRAVAPV
KVAAGEHTANRVVFKQLLQAQALDILQLDACRVAGIPEHLAILLLAAQFGVPVCPHAGGV
GLCELVRHLAMFDYVAVSGTLEDRTVEYVDHLHEHFTDPAVIARGRYTAPSVPGFSSTLR
PASLHAYSYPNGAVWLAERAQGVA
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atgaagcagctgaccagggcacgtatcacggccgtcgacgcatacgacgtccgcttcccc
acctcgcggcggctcgacggctcggacgccatgcaccccgaccccgactactcggccgcc
tatgtgaccatccgcaccgacgccccggacggcctggagggccacggcttctgcttcacc
atcggccggggcaacgaggtggcggtcgcggccatcgacgccctccgcccgcacctgacc
ggcgccgagctcgacggaaccctcaccggcctggccgaccactaccgcgcgctgaccggc
gacagccagctgcgctggctcggcccggacaagggcgtcacgcacatggcgatcggcgcc
gtgctgaacgccctgtgggacctgcacgccaagcgggccggaaagccgctgtggaagctg
ctggccgacctcacccccgaggagctggtggccctcacggacttccgctacctcgccgac
gccctgacccccgatgaggcgctgctgatcctgcgccgcgcggagcccggcaaggccgag
cgcgaggcccggctgcgggccgagggctatcccgcctacgccgcctcccccggctggctc
ggctactccgacgcccacctcgcctcggccgcccgccgggccgtcgccgatgggttcacc
cagatcaagctgaaggtcggcgccgatctcgaggacgacatccggcgctgccggatcgcc
cgcgaggcggtcggcccggacatccggatcgccctggacgccaatcagcggtgggagctg
ggcgaggcggtcgagtggacccgcgcactggccgggttcgacccgtactggatcgaggag
cccacctcccccgacgagatcctggggctcgccgcgattcgccgtgccgttgcacctgtg
aaggttgcggcgggtgagcacacggccaaccgggtggtcttcaaacagctgctgcaggcc
caggccctcgacattctgcagctggacgcctgccgggtcgcggggatcccggagcatctg
gcaatccttctgctcgccgcccagttcggggtcccggtatgcccgcatgcggggggcgtc
gggctctgcgagctggtgcggcacctggccatgttcgactatgtggcggtcagtggaacg
ctcgaggaccggacggtcgagtacgtcgaccatttgcacgagcacttcaccgatcccgcg
gtgatcgcccggggacggtacacggccccctccgtccccgggttcagctccaccctgcgt
cccgcctcgctgcacgcgtactcctaccccaacggtgctgtctggctcgccgagcgggcg
cagggggtggcatga

DBGET integrated database retrieval system