KEGG   Streptomyces bingchenggensis: SBI_08917Help
Entry
SBI_08917         CDS       T01678                                 

Definition
(GenBank) 4-hydroxythreonine-4-phosphate dehydrogenase
  KO
K22024  4-phospho-D-threonate 3-dehydrogenase / 4-phospho-D-erythronate 3-dehydrogenase [EC:1.1.1.408 1.1.1.409]
Organism
sbh  Streptomyces bingchenggensis
Brite
KEGG Orthology (KO) [BR:sbh00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    SBI_08917
Enzymes [BR:sbh01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.408  4-phospho-D-threonate 3-dehydrogenase
     SBI_08917
    1.1.1.409  4-phospho-D-erythronate 3-dehydrogenase
     SBI_08917
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PdxA
Motif
Other DBs
NCBI-ProteinID: ADI12035
UniProt: D7BZZ5
Position
complement(10555215..10556249)
Genome map
AA seq 344 aa AA seqDB search
MNPSPNPASPADGPLPLIAVTMGDGAGIGPEVVVPALLDQDTLRRCRPVAIGDAARLRQA
ARLRGIDCEIVPVSGPEEAEFTPGRINVIDLDLLPADLPWGQLSAVAGDAAYQYIAVAAE
LAMSGAVQGICTAPLNKEALHAGGHIFPGHTELLAHLTGVDEVSMMLATPTVKVIHVTTH
IGLIDAVNRIEPGLVERTVRRGHEAMVRAGTPNPVIGVCGINPHAGENGLFGYGEEEEKI
VPALEVLRADGIDARGPLPADTAFFLAGRGDYDLIVAMYHDQGHGPVKVLGLEAGVNLTV
GLPVIRTSVDHGTAFDIAGTGKADAGSMIEALRQAAEMSSAPAR
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgaacccatcccccaaccccgcctcccccgccgacggcccgctccccctcatcgcggtc
accatgggcgacggcgcgggcatcgggcctgaggtggtcgtccccgccctgctcgaccag
gacacgctgcggcgctgccgcccggtggccatcggggacgcggcgcggctgcgccaggcc
gcccggctgcggggcatcgactgcgagatcgtccccgtctccgggcccgaggaggccgag
ttcaccccggggcggatcaacgtgatcgacctggacctgctccccgccgacctgccctgg
gggcagctgtccgcggtggccggggacgccgcctaccagtacatagcggtggccgccgaa
ctggccatgagcggtgcggtgcagggcatctgcaccgcccccctgaacaaggaagccctg
cacgcgggcggccacatcttccccggccacaccgaactcctcgcccatctcaccggcgtc
gacgaggtctccatgatgctggccaccccgaccgtgaaggtcatccacgtcaccacgcac
atcggcctgatcgacgcggtcaaccggatcgaacccggcctcgtcgagcgcaccgtacgc
cgcggccacgaggcgatggtccgcgccggcaccccgaaccccgtcatcggcgtctgcggt
atcaatccgcacgcgggcgagaacgggctgttcggctacggcgaggaagaggagaagatc
gtccccgcactggaggtgctgcgcgccgacggcatcgacgcccgcggcccgctccccgcc
gacaccgccttcttcctggccggccgcggcgactacgacctgatcgtggcgatgtaccac
gaccaggggcacggcccggtcaaggtgctcggtctggaggccggggtcaatctgaccgtc
gggctgcccgtcatccgcacctccgtcgaccacggcaccgctttcgacatcgccggtacc
ggaaaggcggacgccggtagcatgatcgaggccctgcggcaggcggccgagatgtcctcg
gcccccgcccggtga

DBGET integrated database retrieval system