KEGG   Sorghum bicolor (sorghum): 110430625Help
Entry
110430625         CDS       T01086                                 

Definition
(RefSeq) arginine--tRNA ligase, cytoplasmic-like isoform X1
  KO
K01887  arginyl-tRNA synthetase [EC:6.1.1.19]
Organism
sbi  Sorghum bicolor (sorghum)
Pathway
sbi00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:sbi00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    110430625
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:sbi01007]
    110430625
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:sbi03016]
    110430625
   03029 Mitochondrial biogenesis [BR:sbi03029]
    110430625
Enzymes [BR:sbi01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.19  arginine---tRNA ligase
     110430625
Amino acid related enzymes [BR:sbi01007]
 Aminoacyl-tRNA synthetase
  Class I (G)
   110430625
Transfer RNA biogenesis [BR:sbi03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    110430625
 Prokaryotic type
   Other AARSs
    110430625
Mitochondrial biogenesis [BR:sbi03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    110430625
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1d DALR_1 Arg_tRNA_synt_N
Motif
Other DBs
NCBI-GeneID: 110430625
NCBI-ProteinID: XP_021304138
Position
9
AA seq 656 aa AA seqDB search
MRALAAAATAVAAPTPARLRFRLPLLPRAPRSGHCRAASSSRLVRFSYSATTMGDETSTS
IAPQEQESTVRAGSVKQQLSRLVLSSLRATVPDVEVEPMVEVSAKFADYQCNNAMGLWSK
VKGSGTSFKNPNAIGQAIAKNLPSSDIIESTSVAGPGFVNITLSNRWVAQRIQDMLVNGI
KTWAPTLPVKRAVIDFSSPNIAKEMHVGHLRSTIIGDTLARMFEFSNVDVLRRNHVGDWG
TQFGMLIEYLFEQFPNWKEIGSQAIGDLQIFYKASKHKFDNDPEFKARAQQGVVRLQGGE
EKYREAWKKICDISRSEFDLVYKRLNVVLEEKGESFYNPYIPQVLEELNNKGLIKESEGA
RVIFIQGHQIPLIVVKSDGGFNYASTDLTALWYRLNVEKAEWIIYVTDVGQQQHFDMFFS
AAKMAGWLPDPSEKKFPKTSHVGFGLVLGSDGKRFRTRSTEVVRLVELLDEAKSRSKSEL
QQRLTENGKIVDWTDEELEQTSEAVGYGAVKYADLKNNRLTNYTFSFEQMLSDKGNTAVY
LQYAHARICSIIRKSNKDVEELKMSGAISLDHPDERVLGLYLIRFAEVVEEACTNLLPNV
VCEYLYNLSEMFTKFYTNCQVVGSPEETSRLLLCQATAVVMRQCFNLLGITPVYKL
NT seq 1971 nt NT seq  +upstreamnt  +downstreamnt
atgcgagctctcgcggcagcagcaactgcagtggcggcgcctacccccgcgcgcctccgt
ttccgtctcccgctcctcccccgcgccccgcgctccggtcattgtagagctgcttcttcc
tccaggcttgtgcggttctcgtacagtgccaccaccatgggagatgagacctcgacctcc
attgctccccaggagcaggaatccaccgtgcgggctgggagtgtcaagcaacagctctcc
aggcttgtcctttcatccctccgggctaccgtgcctgatgtggaggtagaacccatggtt
gaagtttcagccaagtttgctgactaccagtgcaacaatgctatgggattatggtcaaag
gttaaaggatctggaactagtttcaaaaaccctaatgccattgggcaggccattgctaag
aacttgccttcttctgatattattgaatccacatctgttgctggacctggttttgtgaac
attaccttatcaaaccgctgggttgcacagagaatacaagacatgcttgttaatggtatc
aagacttgggcaccaactctgccagtaaagagggcagtgattgatttttcatcacctaat
attgcaaaggaaatgcacgtgggacatttaaggtctacaattattggagatacattagca
cgcatgtttgagttctcgaatgttgatgttctgcgaagaaatcatgtgggagattggggt
acacagtttgggatgctaatagaatatctttttgagcaatttcctaattggaaggagata
ggtagccaggccattggggaccttcagattttctataaagcatccaagcacaagtttgac
aatgatccagagtttaaagcaagggctcaacaaggagttgttcggctacagggaggggag
gaaaaatatcgagaagcatggaaaaagatttgtgacattagcaggagcgaatttgacttg
gtctacaagcgcctaaatgtggtgcttgaagaaaagggggagagtttctataatccttat
attcctcaagtgctggaggaattgaataacaaaggcttgatcaaggagagtgagggtgcc
cgagttatatttattcaaggtcatcaaatccctttgatagtggttaagagtgatggtggc
ttcaactatgcctcaacagacttaactgctctttggtatcggctcaatgttgagaaggca
gaatggatcatatatgtgacagatgttggtcagcagcagcactttgacatgtttttcagt
gctgcaaagatggccggttggctcccagatccaagtgaaaagaagtttccaaaaacaagc
catgttggatttggtcttgttcttggttcagatggcaagcggttccgaacccgcagtact
gaggttgttcgattggtagagctacttgatgaggctaaatctcggagcaaatcagaacta
caacaacggctcactgaaaatggcaaaattgttgactggacggatgaggaattagagcaa
acttcagaggcagttggatatggtgctgtgaagtatgctgatctcaagaataatcggctg
actaattacacatttagttttgaacagatgctgagcgataagggaaatactgctgtgtac
cttcagtatgcacatgctcgtatttgttccattattcggaaatccaacaaggatgtggaa
gagctgaagatgagcggagccatttctctcgaccatccagatgagcgtgtgttggggcta
tatcttatccgatttgcagaggttgttgaagaggcctgcacgaatctacttccaaatgtt
gtatgtgaatacttgtacaatctatctgaaatgttcacaaaattctataccaactgccag
gtggtcgggtcaccggaggagacaagccgcctgttgctttgccaagcgactgctgttgtc
atgcgacagtgcttcaacctgctcgggatcacaccagtctacaagctttga

DBGET integrated database retrieval system