KEGG   Sorghum bicolor (sorghum): 110437380Help
Entry
110437380         CDS       T01086                                 

Definition
(RefSeq) tyrosine--tRNA ligase 1, cytoplasmic
  KO
K01866  tyrosyl-tRNA synthetase [EC:6.1.1.1]
Organism
sbi  Sorghum bicolor (sorghum)
Pathway
sbi00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:sbi00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    110437380
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:sbi01007]
    110437380
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:sbi03016]
    110437380
   03029 Mitochondrial biogenesis [BR:sbi03029]
    110437380
Enzymes [BR:sbi01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.1  tyrosine---tRNA ligase
     110437380
Amino acid related enzymes [BR:sbi01007]
 Aminoacyl-tRNA synthetase
  Class I (A)
   110437380
Transfer RNA biogenesis [BR:sbi03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    110437380
 Prokaryotic type
    110437380
Mitochondrial biogenesis [BR:sbi03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    110437380
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1b
Motif
Other DBs
NCBI-GeneID: 110437380
NCBI-ProteinID: XP_021321515
Position
7
AA seq 379 aa AA seqDB search
MDSTPAPEAAPGASSSSAAAAEDLAGAVAAMSLDERFDLLRGIGEECIQEDELRNLLQKK
PVPICYDGFEPSGRMHIAQGIVKTINVNKMIRAGCRVKIWIADWFAQLNNKMGGDLKKIQ
TVGRYMIEIWKAAGMNLDGVEFLWSSEEINSRAHEYWPIVMDIARKNNVKRITRCCQIMG
RSESDDLTAAQIFYPCMQCADIFFLKADICQLGMDQRKVNMLAREYCDDIKRKNKPIILS
HHMLPGFKEGQEKMSKSDPSSAIFMEDDEAQVNVKIKQAFCPPKIVEGNPCLEYIKYIVF
PWFGRFEVVRKEINGGNKTFTSMGELISDYETGALHPADVKPALAKAINEILQPVRDHFN
NNNEAKVLLNTVKKYRVTN
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atggactccacgccggcacccgaggcggctcccggcgcctcctcttcctctgcagctgcc
gccgaggatctggcgggggccgtggcggcgatgagcctggacgagcggttcgatctgctg
cgggggattggggaggagtgcatccaggaggacgagctcaggaacctgcttcagaagaag
cccgtccccatctgctacgacggcttcgagccctctggacgcatgcacatcgctcagggc
attgtgaaaaccatcaacgtgaacaagatgatcagggccgggtgcagggtgaaaatttgg
atcgccgactggtttgcgcagctcaacaacaagatgggaggtgacctgaagaaaatccag
acggtggggcgctacatgatcgagatatggaaagcggctgggatgaacctcgacggggtc
gagttcctgtggtcctccgaggagatcaacagccgcgcgcatgagtactggccaattgtg
atggacattgcccggaaaaataacgtcaagaggataacgagatgctgccaaattatgggc
agaagtgagtcagacgacttgactgctgcccagattttctacccttgcatgcaatgtgca
gatatatttttcttgaaggctgacatatgccagttggggatggaccaacggaaggtcaat
atgctagctagggagtactgcgatgacatcaaaaggaagaacaaaccgattattctttca
catcatatgctccctggttttaaagaaggccaggagaaaatgtcaaagagtgatccatcc
tcggctatctttatggaagatgatgaggcccaggttaatgtgaagataaagcaagctttt
tgccctcccaaaattgttgaggggaatccttgtttggagtacattaaatacattgttttc
ccttggtttggaaggtttgaggtcgtccgtaaggaaatcaatggtggtaacaagacattt
acaagcatgggtgaactaatttctgattatgagacgggtgctttgcatcctgccgatgtc
aaacctgcactagcaaaagcaataaatgaaattttgcagcctgttcgtgatcacttcaac
aacaacaacgaagccaaagttctacttaacactgtcaagaagtacagagtaaccaattga

KEGG   Sorghum bicolor (sorghum): 8057469Help
Entry
8057469           CDS       T01086                                 

Definition
(RefSeq) tyrosine--tRNA ligase, chloroplastic/mitochondrial
  KO
K01866  tyrosyl-tRNA synthetase [EC:6.1.1.1]
Organism
sbi  Sorghum bicolor (sorghum)
Pathway
sbi00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:sbi00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    8057469
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:sbi01007]
    8057469
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:sbi03016]
    8057469
   03029 Mitochondrial biogenesis [BR:sbi03029]
    8057469
Enzymes [BR:sbi01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.1  tyrosine---tRNA ligase
     8057469
Amino acid related enzymes [BR:sbi01007]
 Aminoacyl-tRNA synthetase
  Class I (A)
   8057469
Transfer RNA biogenesis [BR:sbi03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    8057469
 Prokaryotic type
    8057469
Mitochondrial biogenesis [BR:sbi03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    8057469
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1b S4 TyrRSs_C
Motif
Other DBs
NCBI-GeneID: 8057469
NCBI-ProteinID: XP_002447960
Position
6
AA seq 496 aa AA seqDB search
MAAAAAMAAAASSRSFLRPHRCLLLPHTHPLRRRLSTNATASAPTSTAASAGVVDVLMKR
GLVEATTSEALAAARPGELKVYCGFDPTAESLHLGNLLGLVALSWFRRCGHTAVALIGGA
TGRVGDPSGKSSERPELDIAAVEANSDAIKSLVAQILGRVPEPAHHSHSGQKEQPSAISA
DSSQRMGSFVILDNYDWWKEITLLDFLREVGRFARVGSMIAKESVKKRLASEDGMSYTEF
TYQLLQGYDFLYMFKNMGVNVQIGGSDQWGNITAGTELIRKILQVEGAHGLTFPLLLKSD
GTKFGKTEDGAIWLSSKMLSPYKFYQYFFAVPDIDVIRFMKILTFLSLDEIEELEDSMKK
PGYVPNTVQKRLAEEVTRFVHGEEGLEEALKATEALRPGAQTQLDAQTIEGIADDVPSCS
LAYDQVFKSPLVDLAVSTGLLTSKSAVKRLIKQGGLYLNNVRIDSEDKLVEDGDIVDGKV
LLLSAGKKNKMVVRIS
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atggccgccgccgccgccatggccgcggccgcctcctcgcggtccttcctgcgcccgcac
cgttgcctcctcctcccccacacccacccgcttcgccgccgcctctccaccaacgccact
gcctccgctcccacctccaccgctgcgtcggccggcgtcgtggacgtgctcatgaagcga
gggctcgtcgaggccaccacctcggaggcgctcgccgcagcgcggcccggggagctcaag
gtttactgcggcttcgaccccaccgccgagagcctgcatctcggcaacctcctcggcctg
gtcgcgctctcctggttccgccgatgcggccacaccgccgtcgcgctcatcggtggcgcc
acgggccgcgtcggcgacccctcggggaagagttccgagcgccccgagctggacatcgct
gccgtcgaagccaactccgacgccattaagtcccttgtcgcccagatcctcggccgcgtt
cccgagcctgcccaccattcccacagcggtcaaaaagagcagccttcggccatttcagcg
gattcatcacagagaatgggttctttcgtgatcctggacaactacgactggtggaaggaa
atcacgctgctggatttcctgagagaggtgggccgttttgcacgcgtgggttcaatgatt
gccaaggagagcgtcaagaagcgtctcgcgtcagaggacggcatgagctacaccgagttc
acctaccagctgctgcagggctacgacttcctctatatgttcaagaatatgggtgtcaat
gtgcagattgggggcagcgatcagtgggggaacatcacagcgggaactgagttgatcaga
aagatcttgcaggttgagggggcgcacggactcacgttcccgctcctgctgaagagtgac
gggactaagtttgggaagacagaggatggggcaatttggctctcttcgaagatgctttct
ccttacaagttctaccagtacttctttgctgtgccagacatcgatgtcatcaggtttatg
aagatcctgacgttcctgagcttggatgagattgaagagctagaagactcgatgaagaag
cctggctatgtgccaaacactgttcagaagaggcttgcagaagaggttacacgatttgtt
catggcgaggagggactggaggaggcattgaaggcaaccgaggccttgagacctggcgct
caaacacaattggatgcacaaacaattgaggggatagcagatgatgtgccttcatgctct
ttagcttacgatcaagtgttcaagtctccacttgttgatttggctgtttccacaggtttg
ctcactagtaagtcggcggtcaagcggcttattaagcaaggtggtctgtacctgaataac
gttaggattgatagtgaggataagctggttgaggatggtgatatagttgatgggaaggtg
ctcttgttgtctgctggaaagaagaacaagatggttgtgaggatatcttga

KEGG   Sorghum bicolor (sorghum): 8068588Help
Entry
8068588           CDS       T01086                                 

Definition
(RefSeq) tyrosine--tRNA ligase 1, cytoplasmic isoform X2
  KO
K01866  tyrosyl-tRNA synthetase [EC:6.1.1.1]
Organism
sbi  Sorghum bicolor (sorghum)
Pathway
sbi00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:sbi00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    8068588
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:sbi01007]
    8068588
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:sbi03016]
    8068588
   03029 Mitochondrial biogenesis [BR:sbi03029]
    8068588
Enzymes [BR:sbi01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.1  tyrosine---tRNA ligase
     8068588
Amino acid related enzymes [BR:sbi01007]
 Aminoacyl-tRNA synthetase
  Class I (A)
   8068588
Transfer RNA biogenesis [BR:sbi03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    8068588
 Prokaryotic type
    8068588
Mitochondrial biogenesis [BR:sbi03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    8068588
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1b
Motif
Other DBs
NCBI-GeneID: 8068588
NCBI-ProteinID: XP_002454296
UniProt: C5XYV1
Position
4
AA seq 306 aa AA seqDB search
MDNSAVSAMDLYRHTRGMSLVDRFTVLTNTGDECIREVELWFLLKRKTTPVCYVWFEPSP
KMSIDEGIMKTIYVNKIVKAGCTVKILMADLFAVCYKSGSYNLDQVRTIGSYNIEMWRAA
GMDLERVQPVWLSDELNHHPSDYWPLALDISTKSTVDQMARCRVDLESFGPEILSGAELF
YPCLQIAVILVQKTALSYKMKRVFCPPNLTLGNPCLDYIKHVIFPWFGKLEVVHTEGKDG
NRTFASMEELILGYESGVVDSANVKLAFEMALNKILQPVHDHFRDNSRAMALFSSLKKYK
RGRRQA
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atggataattcagctgtttctgccatggacctttacaggcatacaagggggatgagtttg
gttgataggttcacagtcctgacaaacactggggacgaatgtatccgtgaggttgaactt
tggtttcttctgaagaggaagaccacccctgtttgttatgtttggtttgagccatccccc
aagatgagcatagatgagggaatcatgaagacaatctatgtaaataagattgtcaaagct
gggtgcacagttaaaattttgatggctgatttatttgctgtatgctataagtctggatcg
tacaatcttgatcaggtgcggaccattggttcctacaatattgagatgtggagagcagct
ggtatggaccttgagagagttcagcctgtgtggttatcagatgaattgaatcatcatcca
tctgattactggccacttgccttggatatctcgacaaaaagcacagtggatcaaatggca
aggtgtcgtgtggatctggaatcatttggaccagaaatattgtctggtgcagaattgttt
tatccttgcttacaaattgcggtcatcttagtccagaagactgctttaagttataaaatg
aagagagttttctgccctccgaacctgacattaggcaacccatgtttggactatatcaaa
catgtaatcttcccttggtttggaaagttggaggtggttcatactgaagggaaagatggt
aacaggacatttgcaagtatggaagagcttatccttggttatgaaagtggtgtggttgat
tctgctaatgttaagctagcttttgaaatggcattaaacaagatattacagcctgtccat
gaccacttcagggataacagtagagccatggcactgttttcctccctcaagaaatacaag
cgggggagaagacaagcttga

KEGG   Sorghum bicolor (sorghum): 8068589Help
Entry
8068589           CDS       T01086                                 

Definition
(RefSeq) tyrosine--tRNA ligase 2, cytoplasmic
  KO
K01866  tyrosyl-tRNA synthetase [EC:6.1.1.1]
Organism
sbi  Sorghum bicolor (sorghum)
Pathway
sbi00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:sbi00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    8068589
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:sbi01007]
    8068589
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:sbi03016]
    8068589
   03029 Mitochondrial biogenesis [BR:sbi03029]
    8068589
Enzymes [BR:sbi01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.1  tyrosine---tRNA ligase
     8068589
Amino acid related enzymes [BR:sbi01007]
 Aminoacyl-tRNA synthetase
  Class I (A)
   8068589
Transfer RNA biogenesis [BR:sbi03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    8068589
 Prokaryotic type
    8068589
Mitochondrial biogenesis [BR:sbi03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    8068589
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1b
Motif
Other DBs
NCBI-GeneID: 8068589
NCBI-ProteinID: XP_021315261
Position
4
AA seq 344 aa AA seqDB search
MDDQSASSMVANSNSMKMDSVDRFAVLASIGDECIKEVEIQVLLKGKATPVCYVWFEPSS
EMTIAEGIMKTMYVNKMVKAGCTVKVLMADLFARNKKIAYNLDRARAIGCYNIELWKALG
MDLGKVGFMWLSDELNHHPADYWLLALDVSRKNDVDQLSRCRKNMDMEPHELEIFPVAEI
FYPCIQVAALLSQKLQVDMWLLSIDDRDVGKLAKLYAKRANRENNLTILFHRYPELHDKG
GLAQNILMEDEVDTLSFKMRRVFCPLNVASVNPCLEYIRYVILPWFGTFEVVLKEGDGGS
KTFSSMEELIFSYENGVIDSANVKLAFGRALNKILQVQDKRETI
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atggatgatcagtctgcttccagcatggttgctaatagcaatagcatgaagatggattct
gttgataggtttgcagtcctggcaagcataggggatgaatgcataaaggaagttgaaatt
caggtcttgctgaaaggaaaggcaacacctgtttgttatgtttggtttgaaccatcttcc
gagatgacaatagctgagggaatcatgaagacaatgtatgtcaataagatggtcaaagct
ggttgcacagttaaagttttgatggccgatctgtttgcccgaaacaagaagattgcatac
aatctagatcgagcacgagccatcggttgctacaatattgagttgtggaaagcacttggc
atggatcttggtaaagtggggtttatgtggttatcagatgaattaaatcaccatccagct
gattattggctacttgcactggatgtctccaggaaaaatgatgtggatcagttatcaagg
tgtcgcaagaacatggacatggaaccgcatgaactagaaatttttcctgtggctgagata
ttttacccttgcatacaggttgctgccttattaagccagaagttacaggtggatatgtgg
ctcttaagtattgatgatcgagatgtgggcaagttggctaaattgtatgcaaagagagca
aatagggaaaacaatctaactattttgttccacagataccctgagttgcatgacaaggga
ggtttggcacagaatatactcatggaagatgaagtggatactttaagttttaaaatgagg
agagttttctgccctctgaatgtagcatcagtcaacccttgtttggagtatatcagatat
gtaatcctcccttggtttggaacatttgaggtagttctgaaggaaggggatggtggaagc
aagacattttcaagtatggaagaacttattttcagttatgaaaatggtgtgattgattct
gcaaatgtaaaactagcttttgggagggcattgaacaagattttgcaggttcaggacaaa
cgtgagactatttaa

KEGG   Sorghum bicolor (sorghum): 8073415Help
Entry
8073415           CDS       T01086                                 

Definition
(RefSeq) tyrosine--tRNA ligase 1, cytoplasmic isoform X1
  KO
K01866  tyrosyl-tRNA synthetase [EC:6.1.1.1]
Organism
sbi  Sorghum bicolor (sorghum)
Pathway
sbi00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:sbi00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    8073415
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:sbi01007]
    8073415
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:sbi03016]
    8073415
   03029 Mitochondrial biogenesis [BR:sbi03029]
    8073415
Enzymes [BR:sbi01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.1  tyrosine---tRNA ligase
     8073415
Amino acid related enzymes [BR:sbi01007]
 Aminoacyl-tRNA synthetase
  Class I (A)
   8073415
Transfer RNA biogenesis [BR:sbi03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    8073415
 Prokaryotic type
    8073415
Mitochondrial biogenesis [BR:sbi03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    8073415
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1b
Motif
Other DBs
NCBI-GeneID: 8073415
NCBI-ProteinID: XP_021319234
Position
6
AA seq 478 aa AA seqDB search
MHDGPTCRRAVENGVAKWSLDSGVEKKGKTLAAQALTQTPDRGDGGRSTSTEAARRFATI
NRSPLDFVRVEAMLARASGFVGKAWKRTPNLSVQVLTSPRRCSYMPPQLRHLHSTPTQRE
ILPEEQQLLQNNSVGALPRLDCISKENWSKQRNNVNMQNSAVAAVDSIRDTVEGSFDQRF
ATLKSIGEDRVNDRELELLLKRKSAPICYVWCDPSPWMHISEGIIKTLCVNKMVNSGCKV
KILMTDWLARMDDNIGGNLNKMRNIGLYNIEIWKAVGMALDRVELVWLSDEINRHANKYW
PLAMDVSRKTTVHRIKRCYRNRDPFEEFTAADIFYPSLQCATILFQKVDIWLLGRAQHEA
NLLAREYCKRVRRGNEPIALSHNILPNLLLYPEEEHRRNPFLAIYMEDIEVDISRKIIHA
FCPPKLVEGNPCLEYIKYIVLPWHGKFEVVRKKEDGGDKTFLSMEELTADYVSGALQT
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atgcacgatggccccacctgtcggcgcgcggtagagaacggggtggcaaagtggagtctg
gactctggagtggagaaaaagggtaagactttggccgcccaggccctgacccaaacccct
gaccgtggcgacggcggtcgatcgacgtcgacggaggcagctaggaggtttgcgacgatt
aaccggtcgcccctggattttgtgcgtgtggaggcaatgctagcgcgtgcgtctggcttt
gtgggcaaagcatggaagcgaacacccaatttgtcggtccaggtcttgacctcgccgcgc
cgctgctcctacatgccaccgcagcttcgtcatctccacagtacgccgacacagcgggaa
atactccccgaagaacagcagctgctgcaaaataatagcgtaggagctctaccaaggctg
gactgtatctccaaagagaactggagcaaacagcgcaataatgtcaatatgcagaattca
gctgttgctgctgtcgactctattagggatactgttgaggggagttttgaccagaggttt
gcaacactgaagagcattggggaggatcgcgtcaatgaccgcgagcttgagttactgcta
aaaaggaaatctgcccccatttgctatgtttggtgtgatccctccccctggatgcacata
tctgagggcatcataaagactctctgtgttaataagatggttaattctggttgtaaagtc
aaaatcctaatgacagactggttggcccggatggacgataacattggtggcaatctaaat
aaaatgcggaatattggcttgtacaatattgagatttggaaagcagttggcatggctctt
gatagggtagagctagtgtggttgtcagatgaaataaatcggcatgccaataaatattgg
ccactcgccatggatgtttcaagaaaaaccactgtgcatagaataaaaaggtgttatcgg
aatagagatccttttgaagaattcactgctgctgatatattttacccttccttgcagtgt
gctactatattgtttcagaaggttgacatatggctgttgggcagggctcagcatgaggcc
aacttgttagctagagaatattgcaagcgtgtaagaaggggaaatgagccaattgctctg
tcacacaatatacttccgaatttgttactgtaccctgaagaagaacataggaggaatcca
tttctggctatctacatggaagatattgaggttgatatcagtagaaaaataatacatgct
ttctgccctccaaaattggtggaaggcaatccgtgtttggagtacataaaatatattgtc
ttaccgtggcatggaaagtttgaggtggttcggaagaaagaggatggtggtgacaagacg
ttcctgagcatggaggagcttacagctgattatgtaagtggggctcttcaaacttga

DBGET integrated database retrieval system