KEGG   Sorghum bicolor (sorghum): 8055877Help
Entry
8055877           CDS       T01086                                 

Definition
(RefSeq) beta-glucosidase 30
  KO
K01188  beta-glucosidase [EC:3.2.1.21]
Organism
sbi  Sorghum bicolor (sorghum)
Pathway
sbi00460  Cyanoamino acid metabolism
sbi00500  Starch and sucrose metabolism
sbi00940  Phenylpropanoid biosynthesis
sbi01100  Metabolic pathways
sbi01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sbi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    8055877
  09106 Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    8055877
  09110 Biosynthesis of other secondary metabolites
   00940 Phenylpropanoid biosynthesis
    8055877
Enzymes [BR:sbi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.21  beta-glucosidase
     8055877
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_1 Cellulase
Motif
Other DBs
NCBI-GeneID: 8055877
NCBI-ProteinID: XP_002462569
UniProt: C5X3X5
Position
2
AA seq 505 aa AA seqDB search
MGVGNGMAKLLLPALLLAATACIGVHAKFSRYSFPKDFVFGTGSAAYQYEGAYNEGGKGP
SIWDKFTHIPGKILNNDTGDVADDMYHRYKEDVQLLKDMNLDAFRFSIAWTRILPNGSLS
GGINKEGVAFYNNLINEVIAKGLKPFVTIFHWDTPLALEDKYGGFLSENIIKDYVDFAEV
CFKEFGDRVKAWTTFNEPWTYSYQGYAVGKSAPGRCSSYVNKNCFPGDSAREPYTVTHNI
ILAHAEAVALYNAKYKPAQRGQIGITVVSNWYVPTNASSAADVKAVQRSLDFMYGWFLDP
IVHGEYPGTMLGYLGDRLPRFTAAQAKLIKGSYDFIGVNYYTAYFASAKPAPNGMEQSYD
GDIRANTSGYRDGVPIGTPEFVPIFFEYPQGLRELLLYTSRRYGSPVLYVTENGIAEENN
RTIPLEVALRDGHRIRFHSQHLQFVNHAIRDGVNVKGYFTWTFMDCFEWGDGYLDRFGLI
FIDRLNGLKRYRKESSYWIQNFLKR
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgggtgtcgggaacggaatggcgaagctgcttcttccagctctgcttctggcagcaacc
gcttgcatcggcgttcacgccaagttcagcaggtacagcttccccaaggacttcgtcttc
ggcacaggctccgcggcgtatcagtatgagggtgcctacaacgaaggaggcaaggggcct
agcatatgggacaagttcactcacatcccaggtaagatcttgaacaacgataccggcgac
gtagcagatgacatgtaccatcgatacaaggaggatgtgcaactcctcaaggacatgaac
ttggacgccttccggttctccattgcctggaccaggatcctgccaaacggttccctgagt
ggaggaatcaacaaagaaggcgtggccttctataacaacctcatcaacgaggtcatagcc
aaagggctgaagccatttgtcaccatcttccactgggacacgcccctggccctggaggac
aagtatggaggattcctcagcgagaacatcatcaaggactacgtggacttcgccgaggtt
tgcttcaaagagttcggcgaccgcgtcaaggcctggaccacgttcaacgagccgtggacg
tactcgtaccagggctacgccgtcggcaagtcggcgccgggccggtgctcgtcgtacgtc
aacaagaactgcttccccggcgactcggcgcgcgagccctacaccgtgacgcacaacatc
atcctcgcccacgcggaggcggtggcgctgtacaacgccaagtacaagccggcgcagcgc
gggcagatcggcatcaccgtggtgtccaactggtacgtgcccaccaacgccagctccgcc
gccgacgtcaaggccgtgcagcgcagcctggacttcatgtacggctggttcctggacccc
atcgtgcacggcgagtacccgggcaccatgctcggctacctgggcgaccggctgcccagg
ttcaccgcggcgcaggcgaagctcatcaagggctcctacgacttcatcggcgtcaactac
tacacggcctacttcgcctccgccaagccggcgcccaacgggatggagcagtcctacgac
ggcgacatccgcgccaacacctccgggtaccgcgacggcgtgcccatcggcacgccggag
ttcgtgcccatcttcttcgagtacccgcaggggctccgggagctgctgctctacaccagc
cgccgctacggcagcccggtgctctacgtcacggagaacggcatcgcggaggagaacaac
aggacgattccgctggaggtggcgctcagggacgggcacaggatcaggttccacagccag
cacctgcagttcgtgaaccacgccatcagggacggcgtgaatgtgaagggctacttcacc
tggaccttcatggactgcttcgagtggggggacggctacctggaccgcttcggcctcatc
ttcatcgaccgcctcaacggcctcaagcgctaccggaaggagtccagctactggatccag
aacttcttgaagagatag

DBGET integrated database retrieval system