KEGG   Sorghum bicolor (sorghum): 8056434Help
Entry
8056434           CDS       T01086                                 

Definition
(RefSeq) nicotinamide/nicotinic acid mononucleotide adenylyltransferase
  KO
K06210  nicotinamide mononucleotide adenylyltransferase [EC:2.7.7.1 2.7.7.18]
Organism
sbi  Sorghum bicolor (sorghum)
Pathway
sbi00760  Nicotinate and nicotinamide metabolism
sbi01100  Metabolic pathways
Module
sbi_M00115  NAD biosynthesis, aspartate => NAD
Brite
KEGG Orthology (KO) [BR:sbi00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    8056434
Enzymes [BR:sbi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.1  nicotinamide-nucleotide adenylyltransferase
     8056434
    2.7.7.18  nicotinate-nucleotide adenylyltransferase
     8056434
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CTP_transf_like A_thal_3526
Motif
Other DBs
NCBI-GeneID: 8056434
NCBI-ProteinID: XP_002454770
UniProt: C5XVU3
Position
4
AA seq 251 aa AA seqDB search
MEEVGADVPLPREKLSSGPVRDGGGRGGVVLVATGSFNPPTYMHLRMFELAKDELEQRGY
SVLGGYMSPVNDAYKKKDLLPAAHRIRFCELACKSSSFVMVDPWEAMQKGYQRTLTVLSR
VRNSLCKDGVADQGSLKVMLLCGSDLLESFSTPGVWIPDQVRTICKDFGVICIRREGKDV
GTMIANSDILQECRDNIISVDEIVPNQISSSRVRDCIRRCLSIKYLTSDEVIEYIREHKL
FMETEGVDTTL
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atggaggaggtcggcgcggacgtgcctctcccgcgagagaagctctcctctggaccggtc
agggacggaggaggccgaggtggcgtcgtgctcgtggccaccgggagcttcaatcctccc
acctacatgcacctgcgcatgtttgagttggcaaaggatgaactcgagcagcgaggttat
tctgtgttgggcggctacatgtctccggtgaatgatgcatataagaagaaggacctctta
ccagctgctcatcgaattcgcttttgtgaacttgcgtgcaaaagctcatctttcgtgatg
gttgatccttgggaggcaatgcagaaaggttatcagcgcactttgaccgttctttcgaga
gtccggaactcactgtgcaaggatggtgtagctgaccaaggtagcctaaaggtaatgctt
ttatgtggttctgacttgctcgagtcattcagcactccaggtgtttggatcccagaccag
gtcagaaccatatgcaaggactttggtgtgatatgtatacgccgagaaggaaaggatgtt
ggaacaatgatagccaacagtgatatattgcaagaatgcagggataacatcatttcagtc
gatgagattgtgccaaatcagatcagttcatccagagtaagagactgcataagaagatgt
ctatcgataaagtatcttactagtgatgaagtaattgaatacattagagaacacaagctg
tttatggaaactgaaggcgttgatacaacgttgtaa

DBGET integrated database retrieval system