KEGG   Sorghum bicolor (sorghum): 8057380Help
Entry
8057380           CDS       T01086                                 

Definition
(RefSeq) multiple inositol polyphosphate phosphatase 1
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
sbi  Sorghum bicolor (sorghum)
Pathway
sbi00010  Glycolysis / Gluconeogenesis
sbi00562  Inositol phosphate metabolism
sbi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sbi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    8057380
   00562 Inositol phosphate metabolism
    8057380
Enzymes [BR:sbi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     8057380
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     8057380
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2
Motif
Other DBs
NCBI-GeneID: 8057380
NCBI-ProteinID: XP_002466207
UniProt: A0A1Z5S4A1
Position
1
AA seq 525 aa AA seqDB search
MGMAAPRAPLPLPQLLLLVVAALLAAAPLLHRAAGAEDFDVRRHLSTVTRYDVARESRGV
ISMPSIPDGCRVVHLNLVARHGTRAPTKKRIKELDRLAVRLEALMKEANHGLDSDSLKKI
PSWIKGWESRWKGRTKGGELISEGEEELYNLATRVRERFQDLLDDEYHPDVYSIRATQVP
RASASAVAFGLGLLSGKGKLGQGKNRAFSVLSESRASDICLRFFDSCETYKAYRKRKEPD
VEKQKEPILEHVTAALANRYHLKFTTQDVSSLWFLCKQEASLLNITNQACGLFNEAEVRF
LEWTDDLEGFVLKGYGESINYRMGLPLLKDVVQSMEEAIIAREENHPDGTYEKARLRFAH
AETVVPFSCLLGLFLEGPDFEKIQREEALDLPPLPPQGRNWKGSVVAPFAGNNMLALYQC
PSKISDGSATSGGQSNSYFIQVLHNEAPISMPGCGNKDFCPFEEFKEKIVKPHLKHDYNM
ICKIKSPAASEEPASFPSRVSSFFVGLFSQRGYHAVGAEGVKTEL
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atgggcatggctgctccgcgcgcaccgctacctcttccccagttgctgctcctcgtcgtc
gccgcgctcctcgccgccgctcccctccttcatagggcggccggggcggaggacttcgac
gtccggcgccacctctccaccgtcaccaggtatgatgtggccagagagtccaggggtgtc
atctccatgccgtcaatcccagacgggtgccgtgtcgttcacctcaatctagtggcaaga
catgggactcgtgctcctaccaagaagcgaatcaaggagctggatagattggcagttcga
ctggaagcccttatgaaagaggcaaaccatggccttgatagtgattctctgaagaaaatt
ccatcctggattaaaggctgggaatcacgttggaagggtaggactaaaggtggtgagctg
attagtgaaggggaagaggagctgtacaatttagctacaagagtgagggagaggtttcaa
gatctacttgacgacgaatatcaccctgatgtatattcaataagagcaactcaggttcct
cgagcatcagctagtgccgtggcatttggtttgggactactttctgggaaaggaaagctt
ggacaagggaagaaccgtgccttttctgttctgagtgagagtcgtgcaagtgatatttgt
ctgagattctttgacagctgtgagacatacaaggcatataggaaaaggaaggagcctgat
gtagagaagcaaaaggaaccaattctagagcatgtcacagctgctcttgccaatcgttat
cacctaaaatttacaactcaggatgtttcttccctctggtttctttgtaagcaggaagca
tctttgttgaatataaccaatcaagcttgtgggcttttcaatgaagccgaggttcgtttt
ctagagtggacagatgatttggagggttttgtcctaaaaggctatggtgagtcaattaac
tacaggatgggactgccattgctcaaggatgttgtccagtcaatggaagaagcaataata
gctagagaagaaaaccaccctgatggtacgtatgaaaaggcaaggcttcgatttgcacat
gcagaaactgttgttccttttagctgtcttctcggtctttttcttgaaggtccagacttt
gagaagatacagagggaggaagcgttggacctaccccctttgccgccacagggaagaaac
tggaagggcagtgttgttgcgccttttgctggtaacaacatgctggctttataccaatgc
ccaagcaaaatttcggatggcagcgcaacctctggaggccaaagtaactcatacttcatt
caagttctacacaacgaagccccaatttcaatgcctgggtgcggcaacaaagatttctgt
ccattcgaggagttcaaggagaagattgtgaaaccgcacctgaagcacgactacaacatg
atatgcaagatcaaatccccggcggcaagcgaggagcccgcctcgttcccctccagagtg
tccagtttcttcgtaggactcttctcgcagagagggtaccacgccgtgggcgctgaaggc
gtcaagaccgagctgtag

DBGET integrated database retrieval system