KEGG   Sorghum bicolor (sorghum): 8057638Help
Entry
8057638           CDS       T01086                                 

Definition
(RefSeq) homeobox-leucine zipper protein HOX13 isoform X2
Organism
sbi  Sorghum bicolor (sorghum)
SSDB OrthologParalogGFIT
Motif
Pfam: Homeodomain HALZ CENP-F_leu_zip Herpes_UL25 Homeobox_KN DivIC CENP-Q Cep57_MT_bd MscS_porin
Motif
Other DBs
NCBI-GeneID: 8057638
NCBI-ProteinID: XP_002465732
UniProt: C5WUU6
Position
1
AA seq 324 aa AA seqDB search
MRRQSKRPTASRESPETVEKLAFAEEEALTAGKMEPDEGEMDVDVDDEEEDELAGGRGAA
RSSPCGLGEKKRRLLQEQVRALERCFETDNKLDPDRKARIARDLALQPRQVAVWFQNRRA
RWKTKTLERDFSALRARHDALRADCDALRRDKDALAAEIRELRQKLLSKAPEAAVKLEAT
TGNDAAEERQTTAGAPPAGVCKDGSSDSDSSVVFNDVETSPYSGAAAFEQPAFVGFDAPF
LDTSAAAPTGCSSPPVFEPKWQHGPTTYPFDSYKTCAGGGYGFTEEWLASSDVIGNDGAA
GFFSEDHASSLNFSWCASGVQGWE
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgaggaggcaatccaagaggcccaccgccagccgtgaatccccagaaacagtggagaag
ctggcgttcgcggaggaagaggccctgacggcggggaagatggagcccgacgagggcgag
atggacgtcgacgtggacgacgaagaggaggacgagctggccggcgggcgcggcgcggcg
cggtcgtcgccgtgcgggctcggcgagaagaagcggcgcctgttgcaggagcaggtgcgc
gcgctggagcggtgcttcgagacggacaacaagctggacccggaccgcaaggcccgcatc
gcgcgcgacctcgccctgcagccgcgccaggtcgccgtctggttccagaaccgccgcgcc
cgctggaagaccaagacgctggagcgcgacttctcggcgctgcgcgcgcgccacgacgcc
ctccgcgccgactgcgacgcgctccgccgagacaaggacgcactcgccgccgagataagg
gagctgaggcagaagctgctgtccaaggcgccggaggctgcggtgaagctggaggcgacg
acgggcaatgacgcggcggaggagcgccagacgactgccggcgcgccgcccgcgggggtc
tgcaaggacggctcctcggacagcgactccagcgtggtcttcaacgacgtcgagacgtcg
ccgtactccggcgctgcggcgttcgagcagccggccttcgtcgggttcgatgcgccgttc
ttggacacatcggcggcggcaccgacaggctgctcgtctccccccgtgttcgagcccaag
tggcagcacgggccgacgacataccctttcgactcgtacaagacctgcgccggcggcggc
tatggcttcacggaggagtggctcgccagctcggacgtcatcggcaacgacggcgcggcg
ggcttcttctccgaggatcacgcctccagcctcaactttagctggtgcgcgagtggcgtc
cagggatgggagtga

DBGET integrated database retrieval system