KEGG   Sorghum bicolor (sorghum): 8057875Help
Entry
8057875           CDS       T01086                                 

Definition
(RefSeq) NADPH--cytochrome P450 reductase
  KO
K00327  NADPH-ferrihemoprotein reductase [EC:1.6.2.4]
Organism
sbi  Sorghum bicolor (sorghum)
Brite
KEGG Orthology (KO) [BR:sbi00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    8057875
Enzymes [BR:sbi01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     8057875
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_1 Flavodoxin_1 NAD_binding_1 DUF2685
Motif
Other DBs
NCBI-GeneID: 8057875
NCBI-ProteinID: XP_002444097
UniProt: C5YJG8
Position
7
AA seq 706 aa AA seqDB search
MDSATTSGAMELVAALLRGRVPPELMGGDGAEGRALVATLAAAVLGAALFVLWRRAAAGK
KRKREAAAAAVAEATEVKARAAKGGEDEKAADDGRKKVTVFFGTQTGTAEGFAKALAEEA
KARYDKAIFKVVDLDDYAAEDEEYEEKLKKEKLALFFVATYGDGEPTDNAARFYKWFTEG
NERGVWLNDFEYAVFGLGNRQYEHFNKVAKVVDEILTEQGGKRLVPVGLGDDDQCIEDDF
NAWKEALWPELDRLLRDENDASTGTTYTAAIPEYRVEFIKPEEAAHLERNFSLANGHAVH
DAQHPCQANVAVRRELHTPASDRSCTHLEFDIAGTGLTYETGDHVGVYTENCPEVVEEAE
RLLGYSPDTFFTIHADKEDGTPLSGSSLAPPFPSPITVRNALARYADLLNSPKKTSLVAL
ATYASDPAEADRLRFLASAAGKDEYAQWVVASQRSLLEVMAEFPSAKPPLGVFFAAVAPR
LQPRYYSISSSPSMAATRIHVTCALVHETTPAGRVHKGVCSTWIKNAVPSEESKDCSWAP
IFVRQSNFKLPADPSVPIIMIGPGTGLAPFRGFLQERLAQKESGAELGPSVFFFGCRNSK
MDFIYEDELNNFLEQGALSELVLAFSRQGPTKEYVQHKMAQKASEIWDMISQGAYIYVCG
DAKGMARDVHRVLHTIVQEQGSLDSSKAESFVKNLQMEGRYLRDVW
NT seq 2121 nt NT seq  +upstreamnt  +downstreamnt
atggactcggcgacgacgtcgggggcgatggagctggtggcggcgctgctgcggggccgg
gtgccgccggagctgatgggcggggacggcgccgagggccgggcgctcgtcgccacgctc
gccgccgccgtgctcggcgccgcgctcttcgtgctctggaggcgcgccgccgccgggaag
aagcgcaagcgggaggccgccgccgccgccgtcgctgaggccacggaggtcaaggccagg
gccgctaagggcggcgaagacgagaaggcggccgacgacggcaggaagaaggtcaccgtc
ttcttcggcacgcagaccggcaccgccgaggggttcgccaaggcgcttgctgaggaggcg
aaggcaagatatgacaaggcaatcttcaaagttgtggacttggatgattatgcagcagag
gatgaggaatatgaggagaagttgaagaaggagaagctagcattgttcttcgtggcaacg
tatggagatggtgagccgaccgacaatgctgctaggttctacaaatggttcactgaggga
aatgagaggggtgtctggttaaatgactttgagtatgctgtctttggtctgggcaatcga
cagtatgagcatttcaacaaggttgccaaggtggtagatgagatcctaacagaacaaggt
ggaaagcgccttgttccagttggtcttggagacgatgaccaatgcattgaggatgacttc
aatgcatggaaagaagctctctggccagagttggatcgattacttcgggatgaaaatgat
gcctctacaggcactacatacacagctgctattcctgaataccgggttgaattcatcaaa
cctgaggaggcagctcatttggagagaaacttcagccttgcaaatggccatgcagtccat
gatgcccagcatccttgccaggctaatgtggctgtgcggcgggagctccacacccctgct
tctgatcgttcatgcacccatttggagttcgacattgctggaactggtctcacgtatgag
actggggaccatgttggtgtatacaccgagaactgccctgaggttgtagaggaggcagag
aggttgttgggctactcgccagacacatttttcaccatccatgcagacaaagaggatggt
actccactaagtggcagttctcttgctcctccattcccctccccaatcacagtgaggaat
gcacttgctagatatgctgaccttctaaattcaccgaagaagacttctctggttgcatta
gctacttatgcttcagatccggctgaggctgaccgcctgagattcttggcctctgccgct
gggaaggatgagtatgctcaatgggttgtggcaagtcagaggagcctgttggaagtcatg
gcagagttcccttcggcaaagcctccactaggtgtcttctttgcagctgttgcccctcgt
cttcaaccaagatattattctatttcatcttcacctagtatggcagcaaccaggattcat
gtcacatgtgcgctcgtgcacgaaacaacacccgctggaagggtacataagggagtctgc
tcaacttggattaagaatgctgttccatcagaagagagcaaggattgcagctgggctccg
atatttgtgaggcaatcaaacttcaaactacccgctgatccttcagtgccaatcatcatg
attggccctgggaccggtcttgcacctttccgcggcttcttgcaggagagactagctcaa
aaagaatctggagctgagcttggtccatccgtgttcttcttcggatgcagaaatagcaag
atggacttcatctatgaggatgagctgaacaatttccttgagcaaggagcactgtctgag
ctggttcttgccttctcgcgtcagggccctactaaggaatatgtgcaacacaaaatggca
cagaaagcatctgaaatctgggacatgatatcccaaggtgcttacatctatgtctgtggt
gatgccaaaggcatggccagagatgtacatagagttctccacaccattgttcaggagcag
ggctccctcgacagttctaaggccgagagctttgtgaagaatctccaaatggagggcaga
tatctgagggatgtgtggtaa

DBGET integrated database retrieval system