KEGG   Sorghum bicolor (sorghum): 8062876Help
Entry
8062876           CDS       T01086                                 

Definition
(RefSeq) mitogen-activated protein kinase 6
  KO
K20600  mitogen-activated protein kinase 4 [EC:2.7.11.24]
Organism
sbi  Sorghum bicolor (sorghum)
Pathway
sbi04016  MAPK signaling pathway - plant
Brite
KEGG Orthology (KO) [BR:sbi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04016 MAPK signaling pathway - plant
    8062876
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sbi01001]
    8062876
Enzymes [BR:sbi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     8062876
Protein kinases [BR:sbi01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   8062876
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kdo Kinase-like Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 8062876
NCBI-ProteinID: XP_002467591
UniProt: C5WUG0
Position
1
AA seq 377 aa AA seqDB search
MDSSGGGGGGGGGGAQIKGMATHGGRYVLYNVYGNLFEVSSKYAPPIRPIGRGAYGIVCA
AVNSQTGEEVAIKKVGNAFDNHIDAKRTLREIKLLRHMDHENILALKDVIRPPTRENFND
VYIVTELMDTDLHQIIRSNQPLTDDHCQYFLYQLLRGLKYVHSANILHRDLKPSNLFLNA
NCDLKIADFGLARTTSETDLMTEYVVTRWYRAPELLLNCSQYTAAIDVWSVGCILGEIVT
RQPLFPGRDYIQQLKLITELIGSPDDASLGFLRSDNAKRYMKQLPQFPRQDFRLRFRNMS
PGAVDLLERMLVFDPSRRITVDEALHHPYLASLHDINEEPTCPAPFSFDFEQPSFTEAHI
KELIWRESLAFNPDPPY
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atggattcctccggcggcggcggcggcggcggcggaggaggagcgcagatcaagggtatg
gcgacgcacgggggccgctacgtgctgtacaacgtgtacgggaacctcttcgaggtctcc
tccaagtacgccccgcccatccgccccatcggccgcggcgcctacggcattgtctgcgcg
gctgtcaactcacagacaggggaggaagttgcgatcaagaaggttggcaatgcgttcgac
aaccacatcgacgccaagcggacgctgagggagatcaagctgctgcgccacatggaccat
gagaacatccttgccttaaaggacgtaatacgccccccaactagagagaactttaatgac
gtgtacattgttactgagttaatggatacagatctccatcagatcatacgctcaaatcag
ccattgactgatgatcactgccagtacttcttgtatcagttgctaagagggctaaaatat
gtgcactcagcaaatatattgcaccgcgatctaaagccgagcaatttgttcctaaatgca
aattgtgacctcaagatcgcagactttgggcttgcaaggaccacctcagagacagatctc
atgacagagtatgtggtcactcgttggtacagggcaccagagctgctgttgaactgttca
cagtacactgctgccattgatgtctggtcagttggatgcatattaggtgaaatcgttact
cgccaacccctgtttcctggacgggattacatccagcagttaaaattgatcaccgagctc
ataggctcaccagatgatgcaagcctgggatttcttcgaagtgataatgcaaaaagatac
atgaaacaactaccacagtttccaaggcaggacttccgcctgcgtttccgtaacatgtct
cctggtgcagtcgatttgttggagagaatgcttgtgtttgatccaagcagacggattaca
gttgatgaggctctgcatcacccatacttggcttcacttcatgacatcaatgaagaacct
acctgccctgcacctttcagctttgattttgagcaaccatcctttacagaagcgcatata
aaagaacttatctggagggaatctttagcatttaacccggatcctccctactaa

DBGET integrated database retrieval system