KEGG   Sorghum bicolor (sorghum): 8062881Help
Entry
8062881           CDS       T01086                                 

Definition
(RefSeq) probable glutathione S-transferase GSTU6
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
sbi  Sorghum bicolor (sorghum)
Pathway
sbi00480  Glutathione metabolism
sbi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sbi00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    8062881
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sbi02000]
    8062881
Enzymes [BR:sbi01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     8062881
Transporters [BR:sbi02000]
 Other transporters
  Pores ion channels [TC:1]
   8062881
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C_2 GST_N_4 GST_C GST_C_3
Motif
Other DBs
NCBI-GeneID: 8062881
NCBI-ProteinID: XP_002467599
UniProt: C5WUH3
Position
1
AA seq 229 aa AA seqDB search
MAGGGGELKLLGLWTSPFVIRARLALNLKGLSYEYVEEDVKNKSQLLLASNPVHKKVPVL
IHDGKPVCESQVIVHYIDEVFGATAAAGPSLLPADPYERATARFWAAYVDDKVGSAWRTM
LFAGETDEKMDGAAQAIAALETLESAFQDCSKGKGYFGGDTAGYMDVVLGGYLGWFDVLE
KMIGVRVLDAARTPLLAAWAERFRAGDAAEGILLQDVDKVLEFLKAFFA
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atggctggaggcggcggcgagctgaagctgctgggcctatggaccagcccgttcgtgatc
agggcacgcctcgcgctcaacctcaagggcctgagctacgagtacgtcgaggaggacgtc
aagaacaagagccagctcctcctcgcgtccaatcccgttcacaagaaggtgcccgtgctc
atccacgacgggaagcccgtctgcgaatcacaggtcatcgtgcactacatcgatgaagtc
ttcggcgccaccgccgccgccggaccttcgcttctccccgccgacccctacgagcgtgcc
accgcccgcttctgggccgcgtacgtggatgacaaggtcgggtctgcatggcggactatg
ctgttcgccggtgagacagacgagaagatggacggcgcggcgcaggcgatcgcggcgctg
gagacgctggaaagcgcgttccaggactgctccaaggggaagggctacttcggcggagac
accgccgggtacatggacgtcgtgctcggcggctacctggggtggttcgatgtgttggag
aagatgatcggcgtcagagtcctggatgcggcgaggacgccgctcctggccgcgtgggcg
gagcggttccgcgcgggcgacgcggccgagggcatcctgctgcaggatgtggataaggtc
ctcgagttcttgaaggcgttcttcgcttaa

DBGET integrated database retrieval system