KEGG   Sorghum bicolor (sorghum): 8063560Help
Entry
8063560           CDS       T01086                                 

Definition
(RefSeq) serine/threonine protein phosphatase 2A 57 kDa regulatory subunit B' kappa isoform
  KO
K11584  serine/threonine-protein phosphatase 2A regulatory subunit B'
Organism
sbi  Sorghum bicolor (sorghum)
Pathway
sbi03015  mRNA surveillance pathway
Brite
KEGG Orthology (KO) [BR:sbi00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    8063560
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:sbi01009]
    8063560
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:sbi03036]
    8063560
Protein phosphatases and associated proteins [BR:sbi01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-2 (PP2A)
    Regulatory subunits
     8063560
Chromosome and associated proteins [BR:sbi03036]
 Eukaryotic Type
  Centromeric chromatin formation proteins
   Other centromeric chromatin formation proteins
    PP2A (protein phosphatase 2A)
     8063560
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: B56 MOR2-PAG1_N
Motif
Other DBs
NCBI-GeneID: 8063560
NCBI-ProteinID: XP_002440213
UniProt: C5YVD2
Position
9
AA seq 501 aa AA seqDB search
MWKQFLSKLPRKSSASGDSGQCSNGTGIQRTSSCSSIPSGRPASAIRRMSSAVFPSSVVA
GIEPLVSFKDVPNSEKQNLFVSKLSLCCVVFDFSDPNKSSVEKDIKRQALLDLIEFVEST
NTRFSEAAIAACSRMCAINLFRAFPPNCRSGSSGGGEGDEDEPMFDPAWCHLQLVYELLL
KFIGSSSLDAKIGKKHFDHSFIVKLLNLLDSEDPRERDCLKTILHRVYGKFMVHRPFIRK
AVSNIFYQFVFETDRHNGIAELLEVFGSVISGFALPLKEEHKIFLWRVLVPLHKPKSVGV
YLQQLTYCVTQFIEKDPKLASSVIIGLLRYWPITNCQKEVMFLSEIEEILESTSQAEFQK
CMVPLFRRITHCITSSHFQVAERALFVWNNDHIISLIAQNRQVIMPLVVPALEQNIQNHW
NQAVLNLTVNVKKMFSEMDDDLFSSCLAKYKEEEEKRVSLEAKRKLTWEKLEAAAAFQPV
TGHTAVLVGHQPSANMIATLI
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atgtggaagcagttcctcagcaagctgccccggaagtcgtcggcctcgggggattcaggc
cagtgcagcaatggcaccgggatacagcgcacgagcagctgcagcagcatcccgtctggc
cgcccggcttcagccatccggcgcatgtcatccgccgtcttcccatctagtgttgtggct
ggtatcgagccgctggtctcgttcaaggatgtccccaactcggagaagcagaacctgttt
gtgagcaagctgagcctgtgctgtgttgtctttgatttctcggacccgaacaagagttct
gtggagaaggatatcaagaggcaggcattgctggatcttatagagtttgtcgagtccacc
aatactcgcttctcggaggcggcgatcgcggcctgctctaggatgtgtgctatcaacctg
ttccgggcgttccctccaaactgcaggtctggctcatcaggtggtggcgagggcgacgag
gacgagccaatgttcgatcctgcttggtgccatctgcagcttgtttatgagctgctactg
aaatttattggatcatcatccttggatgcaaagatagggaagaagcactttgatcactca
ttcattgtgaagctcctgaatcttcttgactcagaggatccaagagaaagggattgcttg
aaaactattctgcacagggtatatgggaagttcatggtgcaccgtcctttcattcgcaaa
gcagtgagcaacatattctaccagtttgtctttgagactgatcggcacaatgggatcgca
gagctgctggaggtctttggcagtgtcattagtggttttgcattgcctctgaaagaagaa
cacaagatctttctttggagggttttggttcccctacacaaaccgaaatctgttggtgtg
tatcttcagcagctgacctactgtgtaacacagtttatagaaaaggacccaaagcttgca
agctcagtgataattggtttgttaagatattggccaataacaaattgtcagaaggaagtg
atgtttctcagtgagattgaagagattttggagtctaccagccaggcagaattccagaaa
tgtatggtaccattgtttcggagaatcactcattgtatcaccagttctcacttccaggtt
gctgaaagagcgctcttcgtatggaataatgatcacattatcagcttgattgcacaaaac
cgccaagtgatcatgcctcttgttgttccagcactagagcagaatattcagaatcactgg
aaccaagcagtcctgaatctgactgtgaatgtcaagaaaatgttttctgagatggacgat
gatctcttctcatcatgcctggccaagtacaaggaggaagaagaaaaacgtgtgtcgcta
gaagcgaagcgtaagcttacctgggagaagcttgaggcagctgcagctttccagccagtg
actggccatacagccgtcctagtaggccaccagccatcagcaaatatgatcgccaccctg
atctag

DBGET integrated database retrieval system