KEGG   Sorghum bicolor (sorghum): 8066591Help
Entry
8066591           CDS       T01086                                 

Definition
(RefSeq) methionine S-methyltransferase isoform X2
  KO
K08247  methionine S-methyltransferase [EC:2.1.1.12]
Organism
sbi  Sorghum bicolor (sorghum)
Pathway
sbi00450  Selenocompound metabolism
sbi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sbi00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    8066591
Enzymes [BR:sbi01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.12  methionine S-methyltransferase
     8066591
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aminotran_1_2 Methyltransf_31 MTS PrmA Methyltransf_25 Methyltransf_23 Methyltransf_11 Methyltransf_12 Met_10 Methyltransf_32 Methyltransf_4 Methyltransf_18 tRNA_U5-meth_tr
Motif
Other DBs
NCBI-GeneID: 8066591
NCBI-ProteinID: XP_002440406
Position
9
AA seq 1094 aa AA seqDB search
MAATAGEDKDVDAFLADCTPSGDAAYGAAKAVLERLHDPATRPAARRLLGAVRRRFAASR
AAGEECFRTFHFRIHDVVLDPHVQGFQQRKKLTMMEIPSIFIPEDWSFTFYEGLNRHPDS
IFRDKTVAELGCGNGWISIALAEKWCPSKVYGLDINPRAVKIAWINLYLNALDDDGLPIY
DGEGKTLLDRVEFYESDLLSYCRDNKIELDRIVGCIPQILNPNPEAMSKIVTENSSEEFL
YSLSNYCALQGFVEDQFGLGLIARAVEEGISVIKPSGIMVFNMGGRPGQGVCERLFRRRG
FRITKLWQTKIMQAADTDISALVEIEKNSRHRFEFFMDLVGDQPICARTAWAYLKSGGRI
SHALSVYSCQLRQPNQVKKIFEFLKDGFHEVSSSLDLSFDDDSVADEKIPFLAYLASFLK
ENKSNPCEPPAGCLNFRKLVAGFMKSYHHIPLTPDNVVVFPSRAVAIENALQLFSPALAI
VDEHLTRHLPKQWLTSLAIEGRADCNHADGTVTVIEAPRQSDLLIELIRKLKPQVVVTGM
AQFEAITSAAFENLLNVTKDVGSRLFLDISEHLELSSLPSSNGVLKYLAGKTLPSHAAIL
CGLVKNQVYSDLEVAFAISEDAAVYKALSQTIELLEGHTSLISQHYYGCLFHELLAFQIA
DRHPQQERQPAEVIPQQMIGFSDPAMSTLKAAEFFVPDSAESSIIHMDLDRSFLPVPSAV
SASVFESFVRQNITDSETDVHSSIQQLVKDSYGLSADGCSEIIYGNTSLALFNKLVLCCM
QEQGTLLFPLGTNGHYVSAAKFVNASTLTIPTNFGTGFRIEPKVLADTLKNVSQPWVYIS
GPTINPTGFLYSDNDIQELLSVCAEYGARVVIDTSFSGLEYQTDGWSQWNLEGCLSSLKR
SKPSFSVVLLGELSFELTAAGHDFGFVILSDSSLAETFHSFPSLSRPHNTLKYTFKKLLG
LKNQKDQHFSNLMVEQKEELKNRANHLIKTLESCGWDVAIGCGGISMLAKPTAYIGKPFK
ADGFDGKLDASNIREAILKATGLSINSSSWTGIPDYCRFSFALESGEFERAMGCIARFKE
LVLGGSGQAQMNGV
NT seq 3285 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgacggcgggcgaggacaaggacgtcgacgccttcctcgcggactgcacgccc
tcgggcgacgccgcgtacggcgccgccaaggccgtgctcgagcgcctccacgaccccgcc
acccgccccgccgcgcgccgcctcctcggcgccgtccgccgacgcttcgccgcctcacgc
gccgcgggggaggagtgcttccgcaccttccacttccgcatccacgacgtcgtcctcgac
ccacacgtacaaggtttccaacaaaggaagaagctgacaatgatggagataccaagcatc
ttcattcctgaagattggtccttcactttctacgagggcctcaaccgtcatccagactcc
attttcagggacaagacagtagcagagctgggatgtggcaatggttggatatccattgct
cttgcagaaaagtggtgcccttcaaaggtctatggtctggatataaacccaagagctgtg
aagattgcatggataaacctgtacttgaacgcattagatgatgatggtctcccaatatat
gatggggagggcaaaacattgctcgatagagttgaattctatgaatcagatctcctttct
tactgtagagacaacaagatagagcttgatcgcattgttggatgcataccacagattctc
aacccaaatccagaggcgatgtcaaagattgtaacagagaattcaagtgaggagttcttg
tactccttgagtaactactgtgctcttcagggttttgtcgaggaccaatttggccttggg
ttgattgcacgggcggtggaagaagggatatctgtcataaagccttcaggtattatggta
ttcaacatgggaggtcgaccaggacagggtgtctgtgaacgtctatttcgacgacgtgga
tttcgcatcactaagctctggcaaaccaaaattatgcaggctgctgacacagatatttca
gctttggttgaaattgagaaaaatagcagacatcggtttgagttcttcatggatcttgtt
ggggatcagcctatctgtgctcgcacagcctgggcatacttgaaatctggtggccgcatt
tcacatgctttgtctgtgtatagctgtcaacttcgccagcccaaccaggtgaagaaaata
tttgagtttcttaaagatggattccatgaagtcagcagttcccttgatttatcctttgac
gacgattctgtagctgatgaaaaaattcccttcctagcataccttgctagttttctgaaa
gagaataagtcaaatccctgtgagccgccagctggatgtctaaactttaggaaacttgtt
gctggatttatgaagagctaccatcacattcctctaactcctgataatgtcgttgtgttc
ccttcccgtgctgtggcaatagagaatgctcttcaattgttctcaccggcgcttgcaatc
gttgatgaacatttgaccagacacttgcccaagcaatggttaacatccttagcaattgag
ggaagagcagattgtaatcacgcagacggtacagtcactgtaattgaggcaccacgccag
tcagatttactgattgagttgatcaggaagctgaagcctcaggtggttgttactggcatg
gctcaatttgaggctatcaccagtgctgcttttgagaacttactaaatgtaacaaaagat
gttggttcccggttgttcctggatatttctgagcatttggagttgtctagtctgccaagc
tctaatggtgtattaaaatatcttgctggaaagacattaccgtcgcatgcagctatactg
tgtggtttagtaaaaaatcaggtgtattctgatctggaagttgcttttgccatttccgaa
gatgcagctgtatacaaagcattatcacaaactattgagctattggaaggtcacacttct
ctgatcagccagcactattacggctgccttttccatgagcttctggcatttcaaattgct
gaccggcatccacagcaagagagacaacctgcagaagtgatacctcagcagatgatagga
ttttctgatccagctatgtctactctaaaggctgctgaatttttcgttcctgattcagct
gagtccagcattattcatatggatttagatcgcagctttctgccagtaccttctgcagtg
agtgcctctgtttttgaaagttttgtcaggcagaacatcactgattctgaaactgatgtc
cattccagcatccagcagctggtgaaagatagctatggtttatccgcagatggttgttca
gaaattatctatggcaacacctccctagcactcttcaacaagcttgttctttgttgcatg
caagaacagggcaccttgcttttccccttgggcaccaatggccattacgtctctgcagca
aagtttgtgaacgcgagcaccttgactataccgacaaattttggtacaggattcaggatt
gaaccaaaggttctagctgacactcttaagaatgtatctcagccatgggtgtatatttct
ggccccacaatcaaccctactggttttctgtacagtgacaatgatattcaagagctgctc
tctgtatgcgctgaatatggcgctagggtagtgatagatacctccttctctggcctggag
taccaaactgatggctggagtcagtggaatctggaaggatgcctttcctctttgaaacgt
tcaaagccatcattctctgtggtcctgcttggagagctgtcctttgagctgactgcagca
gggcatgactttgggtttgtgatattgagcgactcatcattggctgagacgtttcatagt
ttccccagcttgagtcggccgcacaacacattaaagtacactttcaaaaagctactgggt
cttaagaaccagaaggatcagcatttctcgaatctaatggtggagcagaaggaggaactg
aagaatcgcgccaaccacttgataaagacactggagagctgtggctgggatgttgccatt
ggttgtggtggcatctcaatgttggcgaagccaactgcctacatcgggaagcccttcaaa
gctgatggtttcgacggcaagctggatgcaagcaacatcagggaagccatcctcaaggcc
actgggctcagcataaacagcagctcctggacggggatccctgactactgccggttcagc
tttgctctggagagcggtgaattcgagcgtgcaatgggatgcatagctcggttcaaggag
ctggttctgggaggcagtggccaggctcagatgaatggtgtctga

DBGET integrated database retrieval system