KEGG   Sorghum bicolor (sorghum): 8067279Help
Entry
8067279           CDS       T01086                                 

Definition
(RefSeq) heat shock 70 kDa protein
Organism
sbi  Sorghum bicolor (sorghum)
Pathway
sbi03040  Spliceosome
sbi04141  Protein processing in endoplasmic reticulum
sbi04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:sbi00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    8067279
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    8067279
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    8067279
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl
Motif
Other DBs
NCBI-GeneID: 8067279
NCBI-ProteinID: XP_002460050
Position
2
AA seq 163 aa AA seqDB search
MDYRDVAEPKQTTVPMYFNDLQRQARIDAGKIAGLDVLRIINEPTAAALDYGLDKMPTND
GGRRTVLVFDLSGGTMDVSILNIDPGIGKGKGRFEVKTVAGDTHLGGADFDNETVKYRLK
EFIRKHDRKIDITKFQDKDNNRKALRRLRTACEKAKRTLSYRL
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
atggactatcgagatgttgctgagccaaaacagaccactgtccccatgtacttcaacgac
ttgcagcgccaggccagaattgatgctggtaaaattgctggactggatgtcttgcgcatc
atcaacgagcccaccgctgcagccctggactatggccttgacaagatgcccaccaatgat
ggagggaggaggacggttctcgtctttgatcttagcggtggcaccatggatgtctctatc
ctcaacattgatcctggtatcggcaaaggtaagggtcgcttcgaggtgaagactgtcgct
ggtgacacacaccttggtggagcagattttgacaatgagacggtgaagtaccgtctgaag
gagttcataaggaaacacgataggaagattgacatcacaaagttccaagataaagataat
aaccggaaggctctccgtcgattgaggacagcctgtgagaaggcaaagagaaccctttca
tataggttgtga

DBGET integrated database retrieval system