KEGG   Sorghum bicolor (sorghum): 8067546Help
Entry
8067546           CDS       T01086                                 

Definition
(RefSeq) tyrosine decarboxylase 1
  KO
K01593  aromatic-L-amino-acid/L-tryptophan decarboxylase [EC:4.1.1.28 4.1.1.105]
Organism
sbi  Sorghum bicolor (sorghum)
Pathway
sbi00350  Tyrosine metabolism
sbi00360  Phenylalanine metabolism
sbi00380  Tryptophan metabolism
sbi00950  Isoquinoline alkaloid biosynthesis
sbi00965  Betalain biosynthesis
sbi01100  Metabolic pathways
sbi01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sbi00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    8067546
   00360 Phenylalanine metabolism
    8067546
   00380 Tryptophan metabolism
    8067546
  09110 Biosynthesis of other secondary metabolites
   00901 Indole alkaloid biosynthesis
    8067546
   00950 Isoquinoline alkaloid biosynthesis
    8067546
   00965 Betalain biosynthesis
    8067546
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sbi04147]
    8067546
Enzymes [BR:sbi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.28  aromatic-L-amino-acid decarboxylase
     8067546
    4.1.1.105  L-tryptophan decarboxylase
     8067546
Exosome [BR:sbi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   8067546
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase Aminotran_1_2 Aminotran_5
Motif
Other DBs
NCBI-GeneID: 8067546
NCBI-ProteinID: XP_002467283
UniProt: C5WMA6
Position
1
AA seq 498 aa AA seqDB search
MGSLPLDAASLRPLDPVAFAGDSGAVLDFLAEYYRDVDKYPVRAADLEPGRLRKLLPEAA
PEHGEPMEDVLEDVRRDILPGLTHWQSPSFFAYFPMNASAAGFAGEMLSAGLNVVPFVWA
ASPAAAELESVVVDWMGTLLGLPQRLLFSGGGGGVLQGSTCEAVVCTLAAARDRALHRLG
HDSIIKLVVYASDQTHVTFQKGARLVGIPPSNFRVIQTTPASGYGLTADAVRAAVDSDVA
RGLVPLYLCATVGTTGLGAVDHVRELGEEARRHGMWLHVDAAYAGSAAICPEFQGYLDGA
ELADSVSMNPHKWFLTNADCCCLWVASPGALTSALSTDPEYLKNVGTGGKKPAAIDYKDW
QISLSRRFRAIKLWVVLRRYGAVGLRAHVRRHVAAAKWLERTVAADERFEVVVPRKFSLV
CFRLRAGFVGDDRVDELNRELLAAVNASGRAFMTHFVVDGKFVIRLAVGGAMTEMRHVMD
VWDLLQANADQVLRRYQL
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atgggcagcctgccattggacgcggcgtcactgcggccactcgaccccgtggccttcgcc
ggtgattcaggcgccgtcctggacttcctcgccgagtactaccgcgacgtggataagtac
cctgtccgggcggccgacctcgagccgggcaggctacggaagctgctccccgaggcggcg
ccagagcacggcgagccgatggaggacgtactggaggacgtgcggcgggacatcctgccg
gggctcacccactggcagagccccagcttcttcgcctacttccccatgaacgccagcgcc
gccgggttcgcgggggagatgctgtcggccggcctcaacgtcgtgccgttcgtgtgggcg
gcgtcgcccgccgcagccgagctggagagcgtggtggtggactggatgggtacgctgctc
gggctgccgcagcggctactcttctcgggcggcggcggcggcgtgctgcaggggagcacg
tgcgaggccgtggtgtgcacgctcgccgcggcgcgggaccgcgcgctgcacaggctcggg
cacgacagcatcatcaagctggtggtctacgcctccgaccagacgcacgtcaccttccag
aagggcgcgcggctcgtgggcatcccgccgtccaacttccgcgtcatccagacgacgccg
gcctccgggtacggcctgaccgccgacgccgtccgcgccgcggtcgacagcgacgtcgcc
cgcggcctggtgccgctgtacctctgcgccacggtggggacgacggggctcggcgcggtc
gaccacgttcgcgagctcggagaggaggcgcggcgccacggcatgtggctgcacgtggac
gcggcgtacgccggcagcgcggccatctgcccggagttccagggctacctcgatggcgcc
gagctcgccgactcggtgagcatgaacccgcacaagtggttcctcaccaacgcggactgc
tgctgtctgtgggtggcaagcccaggtgccctgacctccgcgctgtccaccgacccggag
tacctcaagaacgtcggcacgggggggaagaagccggccgccatagactacaaggactgg
cagatctccctgtcacgcaggttccgcgccatcaagctctgggtggtgctacggcgctac
ggcgccgtcggcctgcgcgcgcacgtccgccggcacgtcgccgcagccaagtggttggag
cggacggtggcggcggacgaacgcttcgaggttgtggtgccgaggaagttctcgctggta
tgtttccgcctccgggcgggtttcgtaggggacgacagggtggacgagctgaaccgggag
ctcctcgcggcggtgaacgccagcggccgggcgttcatgacgcacttcgtggtggacggc
aagttcgtgatccgcctcgcggttggcggtgccatgacggagatgcgacacgtcatggac
gtgtgggacctgctgcaggccaacgccgaccaggttttacggcggtatcaactctaa

DBGET integrated database retrieval system