KEGG   Sorghum bicolor (sorghum): 8067781Help
Entry
8067781           CDS       T01086                                 

Definition
(RefSeq) LEAF RUST 10 DISEASE-RESISTANCE LOCUS RECEPTOR-LIKE PROTEIN KINASE-like 2.4
  KO
K04733  interleukin-1 receptor-associated kinase 4 [EC:2.7.11.1]
Organism
sbi  Sorghum bicolor (sorghum)
Brite
KEGG Orthology (KO) [BR:sbi00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sbi01001]
    8067781
Enzymes [BR:sbi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     8067781
Protein kinases [BR:sbi01001]
 Serine/threonine kinases: TKL group
  IRAK family
   8067781
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Stress-antifung APH PRIMA1 LapA_dom
Motif
Other DBs
NCBI-GeneID: 8067781
NCBI-ProteinID: XP_021318522
Position
6
AA seq 656 aa AA seqDB search
MAAVNSLLLLVLLVAAVHSATLALGQTVKVWSLCSPANYTPGDAYDANLRGMLKDLVTVT
ASYGGNGNSTVGGDNGPADHQSSYGLAICYADAPPEVCRLCLAMAAGNVTLACPRAVAAD
MMYNNCLLRYANASFPASPDMAQRFSFYNNLTRAGEAAISAAALGMLMDRLAPAAAASLR
SFAFGRTNMSAEQSLYGFVQCVAYLSPDDCRRCLRRIAASLPIWTRGGRAYSLTCYTRFE
VMPFYTPPSAKTIVVEPAPPPEPSPAGTTAAAKSRDGKSRKFPSGMVVLAVSTLGAILLI
MVCVIFVFKIRRRGKFQQTIRVNSTTKQNIEELLEDYGSLAPKRYKYSQLKEITRYFSEK
LGEGGYGMVYKGTLPCGMLVAVKFLHDFTRNGEDFINEVFSIRRTSHVNIVTLLGFCLEG
SKRALIYEYMANGSLDKFIYDDNSKTIMGWDKLYEIAIGIARGLEYLHRGCNTRIIHFDI
KPHNILLDDDFISKIADFGLAKLCNPKESYLSMAGMRGTIGFIAPEVFARRFGVVSTKSD
VYSYGMMLLEMVGGRKNLKESVNNSSEMYFPDFIYSHLAEVGSLHTFDMAGETEEMARKM
ASIGLWCIQVSPMSRPTMSKVLEMFEKSADQLEIPPRQHFYSAIQEDSSEESAPTL
NT seq 1971 nt NT seq  +upstreamnt  +downstreamnt
atggcggccgtgaactccctcctgctcctggtgctcctcgtcgccgccgtccacagcgcc
accctggcgctcgggcagacggtgaaagtctggtctttgtgctcgccggcgaactacacc
cctggggatgcctacgacgcgaacctccgcggcatgctcaaggacctggtcaccgtcacg
gcctcctacggcggcaacggcaacagcacggtcggcggcgataacggtccggcggaccac
cagtcgtcctacgggctcgccatctgctacgccgacgccccaccggaggtgtgccggctc
tgcctcgccatggcggccgggaacgtgacgctggcgtgcccgcgcgccgtggccgccgac
atgatgtacaacaactgccttctccggtacgcgaacgcgagcttcccggcgagcccggac
atggcgcagaggttctccttctacaacaacctgacgcgcgccggcgaggccgccatcagc
gccgccgcgctgggaatgctcatggaccggctcgcccccgcggccgccgcgtcgctgcgg
tccttcgcgttcggacgcaccaacatgagcgccgagcagagcctgtacgggttcgtgcag
tgcgtggcgtacctgtcgccggacgactgccgccgctgcctccggcgaatcgccgcgtcg
ttgccgatatggacgagaggagggcgcgcctactcactgacatgctacacgcggttcgag
gtgatgccgttctacacgccgccgagcgcgaagaccatcgtcgtggagccggcgccaccg
cccgagccgtcgccggcgggcacaacagcggcggcgaagtcccgagatggaaaatctcga
aaatttccctcagggatggtggtgctggcggtttcaactcttggagccattctcttgatc
atggtctgtgtcatttttgtcttcaagatccgtaggaggggaaaatttcaacaaaccatt
cgagttaactcaactactaaacaaaatattgaggagcttctagaagattatggctccttg
gctccaaagagatataaatattcacagctgaaggaaataacaagatattttagtgaaaaa
cttggagaaggtggctatggcatggtttataaaggtacattaccatgtggcatgcttgtt
gcagtgaagttcctccatgacttcacaagaaatggagaagattttatcaatgaagttttc
agcatcagaaggacatctcatgttaatattgttactctgcttggtttttgcttagaggga
tccaagcgagctcttatttatgagtatatggctaatggatcactggacaaatttatttat
gatgataattcaaaaacaattatgggatgggacaagctctatgaaatagcaattggtatt
gcaagaggtttggagtatttgcaccgcggctgtaatacacgcatcatacactttgacata
aaaccacacaatatccttcttgatgatgattttatctcaaaaattgctgattttggtttg
gccaagttatgcaacccaaaggagagttacctatcaatggcaggcatgcgagggacaatt
gggttcatcgcacctgaagttttcgcaaggagatttggagtagtttctactaaatcagat
gtctacagctacggaatgatgcttcttgagatggtgggaggaagaaagaacctgaaagaa
agtgtgaacaattccagtgagatgtattttccagactttatctatagtcatttggctgaa
gtgggaagcctacatacatttgatatggcaggggaaacagaagagatggcaaggaaaatg
gcctcgattggcttatggtgtatacaagtgtctcctatgtcccgtccaacaatgagcaag
gttttagagatgtttgagaaaagtgcagatcaacttgagataccaccaaggcaacacttc
tattcagctatacaggaggattcatctgaggagtctgctccgacactgtaa

DBGET integrated database retrieval system