KEGG   Sorghum bicolor (sorghum): 8069064Help
Entry
8069064           CDS       T01086                                 

Definition
(RefSeq) magnesium protoporphyrin IX methyltransferase, chloroplastic
  KO
K03428  magnesium-protoporphyrin O-methyltransferase [EC:2.1.1.11]
Organism
sbi  Sorghum bicolor (sorghum)
Pathway
sbi00860  Porphyrin and chlorophyll metabolism
sbi01100  Metabolic pathways
sbi01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sbi00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    8069064
Enzymes [BR:sbi01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.11  magnesium protoporphyrin IX methyltransferase
     8069064
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Mg-por_mtran_C Methyltransf_25 Methyltransf_23 Methyltransf_12 Methyltransf_31 Methyltransf_11 PrmA CheR MTS CMAS Methyltransf_32 UPF0020 FmrO TehB tRNA_U5-meth_tr TPMT Methyltransf_18 Ubie_methyltran Methyltransf_9 DUF3391
Motif
Other DBs
NCBI-GeneID: 8069064
NCBI-ProteinID: XP_002436414
UniProt: Q5NKT1
Position
10
AA seq 330 aa AA seqDB search
MARAGVSTAPLSRLHSLPPRPSLLHNPQPNVLLLRPQQRKAPATTAAALPTAADLPELSL
PAAAAAAAALAAAVSLSDPERRRRAQAEAAGGGDKEAVRAYFNSTGFERWRKIYGSATEG
VNRVQLDIREGHAQTVAAALSMLRDSPLELAGTTVCDAGCGTGSLAIPLAAEGADVLASD
ISAAMVSEAQRQASLAQATAPGSTTFRMPRFEVRDLESLEGRYDVVVCLDVLIHYPREEA
KAMIRHLASLADKRLLISFAPRTLYFDFLKRVGELFPGPSKATRAYLHAEADIEDALRQA
GWRVANRGFISTQFYFAKLFEAVPVASSSS
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atggcgcgcgccggcgtctccaccgcgccgctctcccgcctccactcccttccaccacgg
ccttccctcctccacaacccgcagccgaacgtcctcctcctccgtccccagcagcgcaag
gcgcccgccaccaccgcggcggcgctaccgacggccgcggacctcccggagctatccctc
ccggccgcggccgccgcggcggccgcgctggctgcggcggtttctctctccgaccccgag
cgccggcggcgcgcgcaggccgaggcggcgggcggcggggacaaggaggcggtccgcgcc
tacttcaactcgacggggttcgagcggtggcgcaagatctacgggtcggcgacggagggc
gtgaaccgcgtgcagctggacatccgcgagggccacgcgcagacggtggcggcggcgctg
tccatgctccgcgactccccgctggagctggcgggcaccacggtgtgcgacgccgggtgc
gggacggggtcgctggccatcccgctcgcggccgagggcgccgacgtcctggcctccgac
atctcggcggccatggtgtcggaggcgcagcggcaggcgtcgctggcgcaggcaacggcg
ccggggtcgacgacgttccggatgccccggttcgaggtccgcgacctggagagcctggag
gggcggtacgacgtggtggtgtgcctggacgtgctcatccactacccgcgggaggaggcg
aaagccatgatccgccacctcgcgtcgctggcggacaagcggctgctcatcagcttcgcg
cccaggacgctctacttcgacttcctcaagcgcgtcggcgagctgttcccgggcccgtcc
aaggccacgcgcgcctacctgcacgccgaggccgacattgaggacgcgctccgacaggcc
ggatggcgcgtcgccaaccgcggcttcatctccacgcagttctacttcgccaagctcttc
gaagccgtgcccgtcgcctcctcgtcgtcgtag

DBGET integrated database retrieval system