KEGG   Sorghum bicolor (sorghum): 8070021
Entry
8070021           CDS       T01086                                 

Definition
(RefSeq) uncharacterized protein LOC8070021
Organism
sbi  Sorghum bicolor (sorghum)
SSDB
Other DBs
NCBI-GeneID: 8070021
NCBI-ProteinID: XP_002445453
UniProt: C5YKN0
Position
7
AA seq 449 aa
MLSTASAPSTSLAAAFRSYRARRRRRALWLRPVASAASASGVGDDGGAERFATSSSITDY
LRYRRPELGGAGGGAGGGGGGGVPGGELQTAVVRFKKRFPWTLIHPFLNVDLVSTVHIAD
KEYFDRLQQELEDYDCVLYEMVTSRENLNNPKGPMAAKKMKSSRRGFSILGFIQKQMARV
LSLDYQLDCLDYGNEKWQHADLDYETFKQLQSERGESILTFAVDMTLKSTKALVQPSNMP
DGLDFWRSKLLWASRVLPMPLVGLLVITGLCLPVENQDGFPELEALSRLDFGAALKIFLA
KQLTSEFTAVPTPVEEKSVIIGERNRVATEKIKEAINCGYKRIAVLYGGGHMPDLGRRLR
EELNMVPADVQWVTAWSIRSREIDNKSLPFLKTLAEASGWPLNRYETLALLIFSSVLAVD
LWFWELFFGTAVSWASLAGSWIDQVSSSF
NT seq 1350 nt   +upstreamnt  +downstreamnt
atgctctcgacggcttcggcgccgtccacctcgctcgccgcggccttccgctcgtaccgc
gcgcgccgccggcgccgcgccctctggctgcgccccgtcgcgtccgccgcctcggcgtcc
ggggtcggggacgacggaggggcggagcggttcgccaccagcagctccatcaccgactac
ctccgctaccgacgccccgagcttggcggtgccggaggaggagcgggaggcggaggtgga
ggtggggtgccaggcggggagctgcagacggcggtggtgcgcttcaagaagcgcttcccg
tggacgctcatccaccccttcctcaacgttgatttggtttctacagtccacattgcagac
aaagaatattttgatagactgcagcaagagcttgaagattatgactgtgtcctgtatgaa
atggttacgagtcgtgagaatttgaacaatccgaaaggtccaatggctgctaagaagatg
aaatcttcacgtagaggatttagtattcttggtttcatacagaagcaaatggctcgggtt
ctttcattggattatcagttagactgtcttgattatggcaatgagaaatggcaacatgct
gaccttgactatgaaacattcaagcagcttcagagtgaaagaggtgaaagtattctcacg
tttgccgtagacatgacactgaaatcaaccaaagccttggtgcagccaagtaacatgccg
gatggtcttgacttttggagatccaagttactatgggcctcacgtgtgctaccaatgccg
ctcgttgggctactcgtcatcactgggctgtgtctgccagtggaaaaccaagatggattt
cctgagctggaggcattgtctaggctagattttggagctgcactgaagattttcttggca
aagcaactgacatctgagttcacagctgtgcctacacccgttgaggagaaatcagttatc
attggtgagaggaacagagttgctactgagaagattaaggaagcaataaactgtgggtac
aagagaatagcagtcctgtatggcggcggacacatgccagacctgggaagacgtcttcga
gaagagctcaatatggtcccagccgacgtgcagtgggtcaccgcatggtcaataagaagc
cgggagatagacaacaaatcccttccgttcttgaagacattggctgaagcttcaggctgg
cctttgaatagatacgagacgcttgctctgctcatcttctcttcagttctcgcggtggat
ctttggttctgggaactcttctttggtactgcagtgagttgggcatctctagctggttcc
tggattgaccaggttagcagttcattttga

DBGET integrated database retrieval system