KEGG   Sorghum bicolor (sorghum): 8070599Help
Entry
8070599           CDS       T01086                                 

Definition
(RefSeq) flavonoid 3'-monooxygenase
  KO
K05280  flavonoid 3'-monooxygenase [EC:1.14.14.82]
Organism
sbi  Sorghum bicolor (sorghum)
Pathway
sbi00941  Flavonoid biosynthesis
sbi00944  Flavone and flavonol biosynthesis
sbi01100  Metabolic pathways
sbi01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sbi00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00941 Flavonoid biosynthesis
    8070599
   00944 Flavone and flavonol biosynthesis
    8070599
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:sbi00199]
    8070599
Enzymes [BR:sbi01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.82  flavonoid 3'-monooxygenase
     8070599
Cytochrome P450 [BR:sbi00199]
 Cytochrome P450, plant type
  CYP75 family
   8070599
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: p450
Motif
Other DBs
NCBI-GeneID: 8070599
NCBI-ProteinID: XP_002452385
UniProt: C5XWI3
Position
4
AA seq 517 aa AA seqDB search
MHVPLLLGSLAVSVVVWCLLLRRGGDGKGKGNGKRPLPPGPRGWPVLGNLPQVGSHPHHT
MYALAKEYGPLFRLRFGSADVVVAASARVAVQFLRAHDANFSNRPPNSGAEHMAYNYQDM
VFAPYGSRWRALRKLCALHLFSAKALDDLRGVREGEVALMVRQLALHQHQHAGVPLGQVA
NVCATNTLARATVGRRVFAVDGGEEAREFKDMVVELMQLAGVFNVGDFVPALAWLDLQGV
VGKMKRLHRRYDDMMNSIIRKRKAAEEGKDLLSVLLARMREQQSLADGEDSRINETGIKA
LLLDLFTAGTDTTSSTVEWALAELIRHPDVLKKAQEELDAVVGRDRLVSETDLPRLTYLT
AVIKETFRLHPSTPLSLPRVAAEECEVDGFRIPAGTTLLVNVWAIARDPEAWPEPLQFRP
DRFLPGGSHAGVDVKGSDFELIPFGAGRRICAGLSWGLRMVTLMTATLVHALDWDLADGM
TADKLDMEEAYGLTLQRAVPLMVRPTPRLLPSAYAAE
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
atgcacgtgccgctgttgctgggctccctggccgtctccgtcgtggtgtggtgcctcctg
ctccgccgcggcggggacgggaaggggaaggggaacgggaagcggccgctgccgcccggt
ccccggggctggccggtgctgggcaacctgccgcaggtgggctctcatccgcaccacacc
atgtacgcgcttgccaaagagtacggcccactgttccggctccggttcggcagcgccgac
gtggtggtggccgcgtcggcgcgggtggcggtccagttcctgcgcgcccacgacgccaac
ttcagcaaccgtcctccaaactccggagcagagcacatggcgtacaactaccaggacatg
gtattcgcgccctacggctcccggtggcgcgcgctgcggaagctgtgcgcgctccacctc
ttctccgccaaggccctggatgacctgcgtggcgtcagggagggcgaggtggcgctcatg
gtcaggcagctcgccctgcaccagcaccagcacgccggcgtgccgctgggccaggtggcc
aacgtctgcgcgaccaacacgctggcccgggccacggtggggcggcgcgtgttcgccgtg
gacggaggggaggaagccagggagttcaaggacatggtggtggagctgatgcagctcgcc
ggggtcttcaacgtcggcgacttcgtgcctgcgctggcgtggctcgacctgcagggcgtg
gtcggcaagatgaagaggctgcaccgcaggtacgacgacatgatgaatagcatcatcagg
aagaggaaggccgccgaggaaggcaaggacctgctcagcgtgctgctggccaggatgcgg
gagcagcaatcgctcgcggacggcgaggacagcaggatcaacgagactggcatcaaagca
ctcctcctcgacctcttcacggcggggacggacacgacgtccagcacggtggagtgggcg
ctggccgagctgatccggcacccggacgtgctgaagaaggcccaggaggagctggacgcc
gtcgtcggccgcgaccgcctggtttccgagaccgacctcccgcgcctcacgtacctgacg
gcggtgatcaaggagacgttccggctgcacccgtccacgccgctgtcgctgccccgcgtc
gccgccgaggagtgcgaggtggacgggttccgcatccccgccggcaccacgctgctggtg
aacgtgtgggcgatcgcccgcgacccggaggcgtggcccgagccgctccagttccgcccc
gaccgcttcctcccgggcggctcgcacgcgggcgtcgacgtcaaagggagcgacttcgag
ctcatcccgttcggcgccggccgcaggatctgcgcagggcttagctggggcctgcgcatg
gtcacgctcatgacggccacgctggtgcacgccctggactgggacctcgccgacggcatg
accgcggacaagctagacatggaggaggcatacgggctcaccctgcagcgcgccgtgccg
ttgatggtccgcccaacacccaggctgctgccgtctgcatacgcagcggagtag

DBGET integrated database retrieval system