KEGG   Sorghum bicolor (sorghum): 8071735Help
Entry
8071735           CDS       T01086                                 

Definition
(RefSeq) probable methionine--tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
sbi  Sorghum bicolor (sorghum)
Pathway
sbi00450  Selenocompound metabolism
sbi00970  Aminoacyl-tRNA biosynthesis
sbi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sbi00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    8071735
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    8071735
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:sbi01007]
    8071735
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:sbi03016]
    8071735
Enzymes [BR:sbi01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     8071735
Amino acid related enzymes [BR:sbi01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   8071735
Transfer RNA biogenesis [BR:sbi03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    8071735
 Prokaryotic type
   Other AARSs
    8071735
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1g tRNA_bind tRNA-synt_1 Anticodon_1 Hormone_recep tRNA-synt_1e Sigma70_r3
Motif
Other DBs
NCBI-GeneID: 8071735
NCBI-ProteinID: XP_002452612
Position
4
AA seq 802 aa AA seqDB search
MASSPPSPPPKLPIPGRRNILITSALPYVNNVPHLGNIIGCVLSADVFARYCRLRGYNAL
YICGTDEYGTATETKAMEEKCSPKEICDKYHAIHNEVYKWFDIKFDKFGRTSSPQQTEIC
QAIFHKLMENNWLTENTMQQLYCDTCRRFLADRLVEGTCPIEGCTNKAARGDQCDNCSHM
LNPTELIDPKCKVCKNTPHIRETDHLFLDLPLLEGKLVNYINDTSVAGMWSQNAIQATNA
WLKEGLKSRCITRDLKWGVPVPIEKYKDKVFYVWFDAPIGYVSITASYTPEWEQWWKNPD
NVELFQFMGKDNVPFHTIMFPSTLLGTGENWTMMKTISVTEYLNYEGGKFSKSKGIGVFG
NDAKDTNIPPEVWRYYLLMNRPEASDTLFTWTDLQAKLNSELLNNLGNFINRVLSFIAKP
VGAGYDSIIPDAPGAESHPSTSDIAEKVSKSVEQYLDAMEKVKLKQGLKSAMGISTDGNR
YLQESEFWKLYKDNPANCAIVMKTSVGLVYLLACLLEPFMPSFSKEVLRQLNLSPEETLS
FSEEKGESAKAKTPWDLVPAGHKIGRPVPLFEELKDEKVSKHRETYAGSQAERRSKAVAD
AEATKIANQLNSIALSGGSKKEQKKKSGNSKSKVAEAEISVAKLEIRVGLIRKAEKHPDA
DSLYVEEIDVGEEAPRTVVSGLVKYIPLEEMQNRKVCVLCNLKPVVMRGIKSHAMVLAAS
NEDHTRVELVEPPADAAVGERVTFAGHSGEPEASLSGKSKVWEKLAADLHSSGELVACYK
DVPFMTSAGVCKVKTIANGEIR
NT seq 2409 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcgtcgccgccgtcaccgccgccgaagctgccgatccccggccgccgcaacata
ctcatcaccagcgccttgccctatgtgaacaacgtcccgcacctcgggaacatcatcgga
tgcgtgctgagcgccgacgtgttcgcgcgctactgcaggctgcgcgggtacaacgcgctc
tacatatgcgggacggacgagtacgggacggccacggagaccaaggccatggaggagaag
tgctcgcccaaggagatttgtgacaagtaccatgctatccacaacgaggtttacaagtgg
tttgacataaaatttgacaaatttgggcgtacgtcctctcctcagcagacagaaatctgc
caagcaattttccataaattgatggaaaacaattggctaacagaaaacaccatgcagcag
ctttactgtgatacatgtagaaggtttttggctgataggcttgtagaaggaacatgccct
atagaagggtgtactaataaagctgccagaggtgatcaatgtgacaattgcagccatatg
ttgaatccaactgaactaattgatccaaagtgtaaggtctgtaagaatactccccatatt
cgtgaaacagatcacttattcttggatctccctctattagaaggcaagttggtgaactat
attaatgatacttcagtagctggtatgtggagtcaaaatgccattcaagctacaaatgca
tggttaaaggaaggactaaagtcacgctgtatcacaagagatcttaaatggggggttcct
gttccaattgagaagtataaagataaggttttctatgtctggttcgatgcaccgattggc
tatgtgtccatcacagcatcttatacacctgagtgggagcagtggtggaagaatcctgat
aatgtggaattatttcagttcatgggcaaagataatgtaccatttcatacgatcatgttt
ccgtcaacactactaggaaccggtgaaaattggacaatgatgaagaccattagtgtcact
gaatatctgaactatgaaggaggaaaattctccaagagtaagggtatcggagtttttggt
aatgatgccaaggatacgaatattcctcctgaagtgtggcgatactacctgcttatgaat
cggcctgaggcatcagatacactttttacatggactgatttgcaagccaaattgaacagc
gagttgttaaacaacttgggaaacttcatcaatcgtgtgctcagctttattgcaaaacca
gtgggagctggatatgattcaattatacccgacgctcctggtgctgagtcacatccatcg
acaagtgacattgcagaaaaagtcagtaaatccgttgaacaatatcttgatgcaatggaa
aaggttaagctaaaacaaggactgaagagtgcaatgggcatctctactgatggaaatcgc
tatttgcaagaaagtgaattttggaaactttataaggacaatccagcaaactgtgcgatt
gtgatgaaaacttcagttggtcttgtatatctccttgcctgtctgttggagcctttcatg
ccttccttctcaaaagaagtgctacgtcaattaaacctgtccccagaagaaactctttct
ttcagtgaagaaaagggcgaaagtgcgaaggcaaaaaccccttgggatcttgtaccagca
gggcacaaaatagggaggcctgtacctctgtttgaggaattgaaagatgaaaaggtgagt
aagcatagggaaacatatgcaggcagtcaagctgagaggaggtcaaaagcagtggctgac
gctgaagccacaaaaattgctaaccagctcaacagcatagcattatctggaggctcaaaa
aaggaacaaaagaaaaagtctggtaactcaaaatcaaaggtggcagaggcagaaatatct
gttgcaaagttggagattcgagtggggcttatcagaaaagcagagaagcacccagatgct
gattcgctgtatgtagaggaaatcgatgttggagaggaggctccaagaacggtggttagt
ggccttgtcaaatacattcctcttgaagaaatgcagaaccggaaagtctgtgttctctgt
aatctgaaaccagtggtgatgcgtggtataaaatcacatgccatggttttggctgcttct
aatgaggatcatactagggttgagttggttgagccaccagcggatgctgccgtgggggag
agggtgacctttgctgggcactccggtgagcctgaggcttctctcagtggcaagagcaag
gtgtgggagaagctagccgctgacctgcatagcagcggcgagcttgtggcctgctacaaa
gatgtccctttcatgacttcggctggagtgtgcaaggtgaagacaatagcaaatggggaa
atccgctag

DBGET integrated database retrieval system