KEGG   Sorghum bicolor (sorghum): 8072705Help
Entry
8072705           CDS       T01086                                 

Definition
(RefSeq) uncharacterized protein LOC8072705
  KO
K06195  ApaG protein
Organism
sbi  Sorghum bicolor (sorghum)
Brite
KEGG Orthology (KO) [BR:sbi00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    8072705
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DUF525 UVR DUF4354 CBM49
Motif
Other DBs
NCBI-GeneID: 8072705
NCBI-ProteinID: XP_002440691
UniProt: C5Z144
Position
9
AA seq 290 aa AA seqDB search
MQWAGLRSQAPVPTAAWTGPRPRIARWPQGRFTAARRALVASAAASDANSSSNSPGRDEE
REEVVQREKKEKAVASLLMRSQKYAMLKQQLAVAAQFEDYKEAARLRDSLRSFEEEEPVL
RLRRLMKKAIDEERFEDAAKYRDELMILAPHSLLKCSSDATTLGIRVQVRSVYIESRSQP
LKGQFFFAYRIRITNNSQRPVQLLRRHWIVTDGNGRTENIWGVGVVGEQPVIFPKTGFEY
SSACPLSTPNGRMEGDFEMKHIDKAGSSTFNVAIAPFSLSILGDDNDVLL
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atgcagtgggcgggtctaaggtcgcaggcgccggttcccacggcggcgtggacggggccg
aggccaagaatcgcgaggtggccgcagggtagattcactgcagcgcgccgggcgctggtg
gcgtcagcagcggcctcggacgctaattcgagctcgaattcgccggggagggacgaggag
agggaggaggtggtgcagagggagaagaaggagaaggcggtcgcgtcgctgctgatgagg
agccagaagtacgccatgctaaagcagcagctcgccgtggccgcccaatttgaggattac
aaggaagcagcgaggctgagggactcgctgaggtcgttcgaggaggaggagcccgtgctg
cgcctccgcaggttgatgaagaaggccattgacgaggagaggtttgaggatgctgctaaa
tacagagatgaattaatgattttggctccacactccctcctcaaatgttccagcgatgca
actactttgggcataagagttcaagtcaggagcgtctatattgaaagccggagccagcca
ttgaaaggccaattcttttttgcttatagaattagaatcacaaataattctcagcgccct
gttcagcttctcagaagacactggattgttacagatggaaatggaaggacggaaaatatt
tggggagttggagtagtgggagaacaacctgtcattttcccgaagactggttttgagtac
tcttctgcatgcccattgagcactccaaatgggagaatggaaggtgactttgagatgaag
cacatcgacaaggctggatcatcaacattcaatgtcgcaatcgcgccattctctctgtca
attcttggggacgacaatgatgttctgctctaa

DBGET integrated database retrieval system