KEGG   Sorghum bicolor (sorghum): 8074234Help
Entry
8074234           CDS       T01086                                 

Definition
(RefSeq) probable mediator of RNA polymerase II transcription subunit 37c
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
sbi  Sorghum bicolor (sorghum)
Pathway
sbi03040  Spliceosome
sbi04141  Protein processing in endoplasmic reticulum
sbi04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:sbi00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    8074234
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    8074234
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    8074234
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:sbi01009]
    8074234
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:sbi03041]
    8074234
   03009 Ribosome biogenesis [BR:sbi03009]
    8074234
   03110 Chaperones and folding catalysts [BR:sbi03110]
    8074234
   04131 Membrane trafficking [BR:sbi04131]
    8074234
   03051 Proteasome [BR:sbi03051]
    8074234
   03029 Mitochondrial biogenesis [BR:sbi03029]
    8074234
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sbi04147]
    8074234
Protein phosphatases and associated proteins [BR:sbi01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     8074234
Spliceosome [BR:sbi03041]
 Complex B
  Other components
   Prp19 complex
    8074234
 Complex C
   Prp19-CDC5 complex
    8074234
Ribosome biogenesis [BR:sbi03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    8074234
Chaperones and folding catalysts [BR:sbi03110]
 Heat shock proteins
  HSP70 / DNAK
   8074234
Membrane trafficking [BR:sbi04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    8074234
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    8074234
Proteasome [BR:sbi03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    8074234
Mitochondrial biogenesis [BR:sbi03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    8074234
Exosome [BR:sbi04147]
 Exosomal proteins
  Proteins found in most exosomes
   8074234
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl FGGY_C Hydantoinase_A
Motif
Other DBs
NCBI-GeneID: 8074234
NCBI-ProteinID: XP_002442353
UniProt: C5YPZ1
Position
8
AA seq 649 aa AA seqDB search
MAGKGDGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN
QVAMNPINTVFDAKRLIGRRFSDASVQSDIKLWPFKVISGPGEKPMIVVQHKGEEKQFAA
EEISSMVLIKMREIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVLRIINEP
TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD
NRMVNHFVQEFKRKNKKDITGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLYEGIDFY
STITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSSVHDVVLVGGSTRIPRVQQLLQDFF
NGKELCKNINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLI
PRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQI
TVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQDAEKYKSEDEEHKK
KVEAKNSLENYAYNMRNTIKDEKIASKLAGDDKKKIEDAIDAAISWLDANQLAEADEFED
KMKELESLCNPIIAKMYQGAGADMGGAGGMDEDAPAGSGGPGPKIEEVD
NT seq 1950 nt NT seq  +upstreamnt  +downstreamnt
atggccggcaagggagacgggccggcgatcggcatcgacctcggcacgacctactcgtgc
gtcggcgtgtggcagcacgaccgtgtcgagatcatcgccaacgaccaggggaaccgcacc
acgccctcgtacgtcgccttcaccgactccgagcgcctcatcggagatgcggccaagaac
caggtcgccatgaaccccatcaacaccgtctttgatgccaagcggctcatcggcaggagg
ttctctgatgcttctgtccagagtgatatcaagctctggcccttcaaggtcatttctggg
cctggtgagaagccaatgattgttgtccagcacaagggtgaggagaagcagtttgcagct
gaggagatctcctctatggttctcatcaagatgcgtgagatcgctgaagcttaccttggc
agcacgatcaagaatgctgttgtcacagtccctgcctacttcaacgactcacagaggcag
gccacaaaggatgctggggtgattgctggcctcaacgtcctccgtatcatcaatgagcca
actgctgctgctatcgcctatggtcttgacaagaaggcaaccagtgttggcgagaagaat
gtcctcatctttgaccttggaggtggtaccttcgatgtctccctcctcaccattgaggaa
ggcatctttgaggtcaaggccacagctggtgacacccatctgggtggtgaggactttgac
aacaggatggtgaaccacttcgtccaggagttcaagaggaagaacaagaaggacatcact
ggcaacccgagggctctcaggaggctgaggactgcttgtgagagggcgaagaggactcta
tcttccactgctcagaccaccattgagatcgactctctgtacgagggcatcgacttctac
tccaccatcacccgtgccaggtttgaggagctcaacatggacctgttcaggaagtgcatg
gagcccgtggagaagtgcctgagggatgccaagatggacaagagcagcgtgcacgacgtt
gtccttgttggtggctccacccgtatccccagggtgcagcagctgctccaggacttcttc
aacggcaaggagctgtgcaagaacatcaaccccgatgaggccgtcgcctacggtgccgct
gtccaggccgccatcctgagcggcgagggcaacgagaaggtgcaggacctgcttctgctg
gacgtcacccctctctcccttggcctggagaccgccggaggagtgatgaccgtgctgatc
ccgaggaacaccaccatccccaccaagaaggagcaggtgttctccacctactcggacaac
cagcctggtgtcctgatccaggtgtacgagggcgagaggacacggacccgcgacaacaac
ctgctgggcaagttcgagctctccggcatcccccctgcgccccgtggtgtgccccagatc
acggtgtgcttcgacatcgacgccaacggcatcctgaacgtctcggccgaggacaagacg
accgggcagaagaacaagatcaccatcaccaacgacaagggccgtctgtccaaggaggag
atcgagaagatggtgcaggacgcggagaagtacaagtcggaggacgaggagcacaagaag
aaggtggaggccaagaactcgctggagaactacgcctacaacatgcgcaacacgatcaag
gacgagaagatcgcgtccaagctggccggcgacgacaagaagaagatcgaggacgccatc
gacgcggccatctcgtggctggacgccaaccagctcgccgaggcggacgagttcgaggac
aagatgaaggagctcgagtcgctgtgcaaccccatcatcgccaagatgtaccagggcgcg
ggcgccgacatgggcggcgccggcggcatggacgaggacgcacccgcgggcagcggcggc
cctggccccaagatcgaggaggtcgactaa

DBGET integrated database retrieval system