KEGG   Sorghum bicolor (sorghum): 8074510Help
Entry
8074510           CDS       T01086                                 

Definition
(RefSeq) pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH1
  KO
K12813  pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 [EC:3.6.4.13]
Organism
sbi  Sorghum bicolor (sorghum)
Pathway
sbi03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:sbi00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    8074510
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:sbi03041]
    8074510
Enzymes [BR:sbi01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     8074510
Spliceosome [BR:sbi03041]
 Complex B
  U4/U6.U5 tri-snRNP components
   U4/U6.U5 tri-snRNP related factors
    8074510
 Complex C
   U4/U6.U5 tri-SnRNP related factors
    8074510
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: OB_NTP_bind HA2 Helicase_C DEAD AAA_22 AAA_30 T2SSE PWI AAA_19 SRP54 Flavi_DEAD AAA_7 ABC_tran
Motif
Other DBs
NCBI-GeneID: 8074510
NCBI-ProteinID: XP_002457621
UniProt: C5XGK1
Position
3
AA seq 1046 aa AA seqDB search
MATDGQLREWVSDKLMSLLGYSKNVVVQYVIRLAKECSSTGDLVGKLVEFGFTSSAETRA
FASDVYAKVPRRASGISNYQKQEREAAKLAQKQSTYKLLANEDDDTDNQTPTSQKTSRNP
SSKSRKHFRRKADQDSGDDEIVAKDSGRNVRQRTEEEDEESGDGSSDEEKERIRDQQEKA
QLERNMRERDAANTRKLMERQLSKEEQEELTRRSQAMDKNDTSDLRKFSRQAYLQKRRDK
KIEEIRDEILDHQYIFQDVKLTEAEEKELRYKMKIYDLVKEHVETPDDVGEYKMPEAYDM
GENVNQEKRFSVAMQRYKDPEAKDKMNPFAEQEAWGEHQIGKSKLQFGSKDKKPSSDEYQ
YVFEDTIDFVKSSVIVGTQPEDDSDKEDIEAKDILKRELQDERKTLPVFKFGDELLKAVE
EYQVIVIVGETGSGKTTQIPQYLHEAGYTAKGKVACTQPRRVAAMSVAARVSQEMGVKLG
HEVGYSIRFEDCTSDKTIIKYMTDGMLLREFLGEPDLASYSVVMVDEAHERTLSTDILFG
LVKDISRFRPDLKLLISSATLDAEKFSDYFDSAPIFKIPGRRYPVEIHYTKAPEADYIDA
AIVTVLQIHVTQPPGDILVFLTGQEEIETVDEILKHRTRGLGTKISELIICPIYANLPTE
LQAKIFEPTPEGARKVVLATNIAETSLTIDGIKYVIDPGFCKIKSYNPRTGMESLLINPI
SKASANQRAGRSGRTGPGKCFRLYTSYNYMHDLEDNTVPEIQRTNLANVVLTLKSLGIHD
LVNFDFMDPPPSEALLRALEQLFALSALNSRGELTKTGRRMAEFPLDPMLSKMIVASEKY
KCSDEIISVASMLSIGNSIFYRPKDKQVHADNARLNFHTGNVGDHIALLNVYNSWKETDY
STQWCYENYIQVRSMKRARDIRDQLEGLMERVEIEICSNASDLDAIKKVITSGFFHHSAR
LQRDGTYKTVKNPQTVHIHPSSGLAEIRPRWVVYHELVLTTKEFMRQVTELKPEWLVEIA
PHYYQLKDVEDSGTKKLPKGQGRAAL
NT seq 3141 nt NT seq  +upstreamnt  +downstreamnt
atggcgaccgatgggcagctcagggagtgggtctccgacaagctcatgagcctcttgggc
tactccaagaacgtcgtcgtccagtacgtcatcaggctcgcgaaggagtgctcttcaacg
ggtgacctcgtgggtaagctcgtcgagttcgggttcacctcgtctgcggagacccgtgcc
ttcgcgtcggatgtctacgccaaggttccccgcagggccagcggcatcagtaattaccag
aagcaggagagggaggcggcaaagcttgcccagaaacagagcacttacaagctgttggcc
aacgaggatgatgataccgacaaccagacaccaacaagtcaaaagacctcaagaaatcca
tcatctaagagtcggaagcatttcaggaggaaagcagatcaagacagtggtgatgatgaa
atagtggcaaaagattctggaaggaacgtccgtcagcgaacagaagaggaggatgaagaa
agtggcgatggaagttctgatgaagagaaagaaaggattagagatcagcaggaaaaggcc
cagctagaaaggaacatgagagaaagagatgcggctaacacaaggaagttgatggagcga
caattatctaaggaagaacaagaagagcttactagaagatctcaagcaatggacaagaat
gacacatctgatctgagaaaattctcaaggcaagcatacctgcaaaagcgccgggacaaa
aaaattgaggaaattcgtgatgaaattctggaccaccagtacatttttcaggatgtgaaa
ctaacagaggcagaagaaaaggagttgagatacaagatgaagatatatgatcttgtcaag
gaacatgttgagactcctgatgatgttggtgagtacaaaatgcctgaagcttatgacatg
ggtgaaaatgtcaatcaagaaaagagattctctgtggccatgcagcggtacaaagatcct
gaggccaaggataaaatgaacccttttgctgaacaggaagcgtggggagaacaccaaata
ggaaaatcgaaactgcaatttggatccaaagataagaagccgtcttcagatgagtatcag
tatgtattcgaagatacaattgattttgttaaatcatcagtcatagtaggaacccagcct
gaagacgattcagataaagaggacattgaagcaaaagatattttgaaaagggagctccag
gatgagcgaaagacgcttccagttttcaaatttggggatgaactgcttaaggctgtagaa
gagtatcaggttatcgtcatagtgggcgagaccgggtccggtaaaacaacacaaatacct
cagtaccttcatgaggctgggtatactgcgaaaggaaaggttgcatgtactcaacctcgt
cgagtggctgccatgagtgttgcagcaagagtatctcaagaaatgggtgttaaacttgga
catgaggttggttactctataagatttgaggattgcacttcagataaaacaattattaag
tacatgactgatggaatgcttctaagggagttccttggtgaaccagatttggctagctac
agtgttgtcatggtggatgaggctcatgagcgtaccctttccacggatatcttatttggt
ctggtgaaggatatttctcgttttcgaccagacctgaagttgctcatttcgagtgccacg
cttgatgcagaaaaatttagtgactacttcgattcagctcctattttcaagatacctggg
aggcgataccctgttgaaattcattatacaaaagccccagaggctgattacatagatgca
gcaattgtcactgttttacagatacatgtgacacaaccccctggagatatcctggtgttt
cttacaggtcaggaggaaattgaaacagttgatgaaatccttaaacacagaacaaggggc
ttaggcaccaaaatttcagaattaattatatgtcctatttatgcaaatctgcctaccgag
cttcaagctaagatatttgagccaacccccgagggtgcccgtaaggtggttctggccact
aatatagctgagacttcactaaccattgatggtataaagtatgttattgatccaggcttt
tgtaagatcaaatcatacaatccccgcacaggaatggaatctctacttattaatcctatc
tcaaaagcttcagcaaaccagagggcaggaaggtctggacgcactggacctggaaaatgc
ttccgtctatacacgagttataactacatgcacgacctagaagataatactgttccagag
atccaacgaaccaatcttgcgaatgttgtgcttacactcaagagtcttggtattcatgac
ttggttaactttgacttcatggatccacctccatcagaagccctgttaagggctctggaa
caactttttgctctcagtgcactcaacagtcgtggagagttgactaagactggaagaaga
atggcagaatttccactggatcctatgttgtcgaagatgattgttgcttcagagaaatat
aagtgttctgatgagatcatctccgttgcatccatgttgtcaattggcaattctatattt
tatcgtccgaaggacaaacaagttcatgcagataatgcaaggttgaacttccacactggc
aatgttggggaccatatagcactactaaatgtgtataattcttggaaagaaacagactat
tcgactcagtggtgttatgaaaactatatacaggtgcgcagcatgaagagggcaagggat
attcgggatcaactagaggggcttatggaaagagttgagattgagatttgctcaaatgcc
agtgatttagatgctattaaaaaagttataacatcaggtttcttccatcattctgcacgg
ttgcagagggatggtacatataagactgtcaagaaccctcagaccgtacatatccatcct
agttcaggattagcagagatacgtccgcggtgggtagtataccacgaattagttctcaca
acaaaggagtttatgcgccaggtgacagaactgaagcctgaatggctggtagagatagca
ccacattattaccaactaaaggatgtggaagactctggaacaaagaagctaccaaagggc
caaggacgagctgcattgtag

DBGET integrated database retrieval system