KEGG   Sorghum bicolor (sorghum): 8075120Help
Entry
8075120           CDS       T01086                                 

Definition
(RefSeq) acyl-coenzyme A oxidase 4, peroxisomal
  KO
K00232  acyl-CoA oxidase [EC:1.3.3.6]
Organism
sbi  Sorghum bicolor (sorghum)
Pathway
sbi00071  Fatty acid degradation
sbi00592  alpha-Linolenic acid metabolism
sbi01040  Biosynthesis of unsaturated fatty acids
sbi01100  Metabolic pathways
sbi01110  Biosynthesis of secondary metabolites
sbi01212  Fatty acid metabolism
sbi04146  Peroxisome
Module
sbi_M00087  beta-Oxidation
sbi_M00113  Jasmonic acid biosynthesis
Brite
KEGG Orthology (KO) [BR:sbi00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    8075120
   00592 alpha-Linolenic acid metabolism
    8075120
   01040 Biosynthesis of unsaturated fatty acids
    8075120
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    8075120
Enzymes [BR:sbi01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.6  acyl-CoA oxidase
     8075120
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Acyl-CoA_dh_N Acyl-CoA_dh_1 Acyl-CoA_dh_M Acyl-CoA_dh_2
Motif
Other DBs
NCBI-GeneID: 8075120
NCBI-ProteinID: XP_002455160
Position
3
AA seq 437 aa AA seqDB search
MAEKRVTGGDRREEDRAKVGLPALDLSLAFPQATPASIFPPSASDYYQFDDLLTSEERSI
RKKVRGIVEKEIAPIMAAYWEKAEFPFDAIPKLASLGVAGGTIKGYGCPGLSITASAVTM
AEMARVDASCSTFILVHSSLAMVTIALCGSEAQKQKYLPSLAQLTTVGCWALTEPNYGSD
ASSLRTTASKAPGGWHIDGQKRWIGNSTFADVLVVLARNADTQQLNGFIVRKGAPGLKAT
KIENKIGLRMVQNGDIVFNKVFVPEEDRLPGITSFKDISKVLAISRIMVAWQPIGISMGV
FDMCHRYLKERKQFGVPLASFQLNQEKLVRMLGNIQSMLLVGWRLCKLYESGKMTPGHAS
LGKAWNSRMAREVVSLGRELLGGNGILADFLVAKAFCDLEPIYSYEGTYDINSLVTGREI
TGIASFKPAAALAKARL
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atggccgagaagcgagttacgggcggcgataggcgggaggaggaccgcgccaaggtcggg
ctcccggcgttggacctctcactcgcgttcccgcaggccacgccggcctccattttcccg
ccgtccgcttcggattactatcagtttgatgatttgctgaccagtgaagagcgctccatc
aggaagaaggtcaggggtattgtggagaaagaaattgcgcccattatggcagcgtactgg
gaaaaggcagagtttccatttgatgccattcctaaacttgcaagccttggtgttgctggt
ggtacaataaagggttatgggtgcccaggactttcaattacagccagtgctgttactatg
gcagaaatggcacgggtagatgcaagctgttccacatttatactggtgcactcctctctt
gcgatggtgacaatagccctttgtggatctgaggcacagaagcagaagtacttgccatcc
cttgctcaacttactaccgttggctgttgggcattgacagagccaaattatggaagtgat
gcaagctctttgagaactacagcgagcaaggcacctggtgggtggcacatagatggtcaa
aaacgctggatcggtaacagtacgttcgccgatgtgctcgtggtattagctaggaatgca
gatacacaacaactaaatgggttcattgtgaggaaaggagctcctggtctgaaagctaca
aagattgagaacaaaatcggtctcaggatggttcaaaacggtgatatagtatttaataag
gtgtttgtccctgaggaagaccgattgccaggcatcacctcatttaaggatatcagcaag
gtgcttgctatttcgcgcattatggtggcatggcaaccaatcggcatatcgatgggggtc
ttcgatatgtgccaccggtatctgaaagagaggaaacagtttggcgtccctctagcatcc
ttccagctgaaccaagagaagcttgtccggatgctcggtaacatccaatcgatgctcctt
gttggctggcgcctctgcaagctttacgagtcggggaaaatgacgccaggccacgctagc
ctagggaaggcttggaactccaggatggcccgcgaggtggtttcccttggccgagagctg
ctgggtgggaacggaattttggctgatttccttgtggcaaaggcattctgtgacctggag
ccaatttactcgtacgaaggcacatacgacatcaacagcctggtgaccggcagagagatc
accgggatcgcgagcttcaagcccgccgccgcgctagccaaagcccggttgtaa

DBGET integrated database retrieval system