KEGG   Sorghum bicolor (sorghum): 8075210Help
Entry
8075210           CDS       T01086                                 

Definition
(RefSeq) separase
  KO
K02365  separase [EC:3.4.22.49]
Organism
sbi  Sorghum bicolor (sorghum)
Brite
KEGG Orthology (KO) [BR:sbi00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:sbi01002]
    8075210
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:sbi03036]
    8075210
Enzymes [BR:sbi01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.49  separase
     8075210
Peptidases and inhibitors [BR:sbi01002]
 Cysteine peptidases
  Family C50: separase family
   8075210
Chromosome and associated proteins [BR:sbi03036]
 Eukaryotic type
  Sister chromatid separation proteins
   Separase
    8075210
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_C50 TPR_10 CHAT
Motif
Other DBs
NCBI-GeneID: 8075210
NCBI-ProteinID: XP_021314750
Position
4
AA seq 2186 aa AA seqDB search
MEAAAADLVAALSSPSSYAGLHSRFAAYLQPFTSYLTSSNPNPKPPQKRATKLTKQPPPP
DAATLRPLAKRFLPFLVRALHLLPPLVRASPGSGDKGGEAADELFEIYGLLLDCLEAISP
CLAGKPYSVLLQRGSFVRCLESRGHLARANAEAAATLDALRSALSPPTTSTKSRRAAASV
DSVLLPDPGSAGEAGTDPEVAVLAVELTSCLANCCSKGKVKEPAPYDRLLSLFKQLKPWL
RILTNEARRKYLPLLVNGMSRCTFFLVSESSFFSSDLVHGFCRHTVQDCVKEGMIEHLPA
IARKICSSVDLSWEGSTQFLLHVLETVIDSVVHVKDDLPKSVNDLLVFVSYFCWFILSAK
RDLSAGASEVLYKQAGYFSEVYSPTASMLLLYAIGLYLSAQQAENEIPFYLSVGIPKDKK
YLQALEKALGTLARWPHDNTSLVTYLDSLEFISKVLLQQVDTLWKNFSEGKPTHYSGNMN
YVLTALHQFADSSFTSFSYTQMSQGDNERRHGTLLKVLVSAIKFSFVTKKDVQKSLGFIV
RAISSKSLAPEELKFLIPSLSNIGVTLHNTGHVKEAPKALELCCQTIWAHVRLSYCSLSS
RPKGNSILMDIILDAFARIAKLVDTLRRCGTEIETTLGIVVKSLSELLSDCDNSEYFKGS
FILIEAWVKAVHKEFGDNKVDGAPLLYPSLLKNRSPWPIKLIGLIVEQELLAYGLTKAQS
TEFCSKMQIRIIDVLLHKIYCSKEHFLERSRVLVRKAGALRASGVENIKSCLECLHDAIS
LLQKISEDSSDANITANNQLAIAYCLYAHCAQEDSAGGEVIFDNAEKALKLWLKMGTFNH
YSPDMVLQHPSQTIVPLICFLVDLLSMKGCFELQFKLCKVMIMMWKQEKLPLEKLLSLLV
TNGRLSHACCYLPLDERFLSIATEHLDVHSHHINFWINGFEGDDPSVSMFLQRMLPSDLL
IPQSCKHPFGKQLSFDDVSKAASSLVSEVTSNDQSIFLASCLYYDLSERLYSRGELFQAF
SYAKESLHLRKKLLKKKFKLKSGISGNMERKPCRQDFSLEVCGPTIVEIWPDSSRSASMR
DSFLTPWSVLRYYLESTLQVAMMYELIGNAAEAEVHLRTGKEISNFHGFPVFCIVFTSCL
GQLYCKQQLWDEAKSEFNLARDLLVKNDAIISCRICKLTLGISVDVQVGDLSWNLFEKKF
QKQSTADLSNALRMYRCAIEKLNSTDLEYFNGSNDNHKTGCLVCSKDCRIPIKHEAYTCR
KEPTTSKDESFSPCSVCMAIQIRRKRSGNAEAGPPLDAKAKRPSRNSSRLANEQNVETVA
KIRTRSSKRNAHMKSEKVSTELNSKNNISWGDELAADILVCGEGECFPDRIGRSKDDLCN
MFGCWNCLLVKTLNSECIQNILQLRLDCVRRRYHVSALLKKARALGSHSNGDHEVHSVYW
KCISLLFFRSLPQDCYRTYGPYLIGLLMDRSIIGDLLPLECAQILWSMSFFMLKSSLSEQ
PRDICCIFSSVKMADVVPWLLKAFVLSRESPSIIQEVCKLLACIFLLSTIDSSIQLPLGS
HKESLSLNHWAAYFHQVSVGTYLNCHFPSLQASSEEKGTHEDFRNETDDDVSEFLRLSSR
DIIHIEKHMTEFFQKLPNVPVLCISMLGGDYVNPLLKFHRHPLFFRAWILLSRFDSTSEP
TTLLLPVDAISEMQFEDSCIKDLGNPTRVLDKKWQCPWGYGITDDVAPIFRNILEENFMS
LSSAPLSINDVNADHVRWWSHRKKLNNYLANTLKDIENSWFGPWKCLLLGHRLSDEHIEA
ALSSIITYLDTEFEFEANPVLIRAILGGAVSVDEVQECFLQLILYKGYFGRGGCCGKDRL
RAFSSCQMDDGAMDTLQCLITDAVYELPQPDGRGPVILVLDVNVQMLPWENLPVLRNQEI
YRMPSIGSIFLALSRNNNAYKDPLFPVIDPFNTYYLLNPSGDLSSTQEEFDQLFRNYEWK
GLAGNSPEADELVLALTNHDLFLYFGHGSGAQYISSKEIEKIHNCAAALLMGCSSGTLYC
KGSYAPRGAPLSYLFAGSPAIIANLWDVSDKDIDRFSKALLNSWLHDNSLDGNNCSKCCQ
LTKELESMSIASEEKGRARRRGTRGNKQQQISDSTKCCSCRQRRIASSLSEARRACKLPL
LIGASPVCYGMPTIIKKKVMTDSATR
NT seq 6561 nt NT seq  +upstreamnt  +downstreamnt
atggaggccgccgccgccgacctcgtcgctgccctctcttccccgtcctcctacgccggc
ctccactctcgcttcgccgcctacctacagcctttcacctcctacctgaccagctcaaac
cctaaccccaagccaccgcagaagagggcgacgaagctgaccaagcagccgccgcctccc
gacgcggccaccctccgccccctcgcgaagcgattcctcccgtttctcgtccgcgcgctc
cacctcctcccgccgctcgtccgtgcgagtcctggctcgggcgacaagggcggtgaggcc
gccgacgaactgtttgagatctacggccttctcttggactgcctagaggccatatcaccc
tgcctcgctgggaagccctactccgtgttgctccagcgcggctccttcgtccgttgcctc
gagtcgcgcggccacctcgcacgcgccaatgcggaggctgccgctaccctcgacgccctc
cgctccgcgctctctccacccaccacgagcaccaagtcgcgacgtgctgctgcaagcgtt
gattcggtcctccttccggaccctggcagcgctggggaggctggcacggatcctgaagtc
gccgtactcgcggtcgagctcacttcctgccttgccaattgttgcagcaagggcaaggtg
aaggaacctgccccttacgaccgacttctcagccttttcaagcagctaaaaccatggctt
cgcattcttactaatgaagccaggaggaagtatctcccgctgcttgtgaatggcatgagc
cggtgcaccttttttctggtatcagagtcttcatttttcagtagtgatctagttcatgga
ttctgtcggcacacagtgcaagattgtgtgaaagagggcatgatcgagcatttgccagca
attgctcgcaagatttgctcttctgtagatctgagttgggaagggagcacacagttttta
ctccatgtgctagaaactgtcattgattctgttgtacatgtaaaggatgatttaccgaaa
tctgtgaatgatcttctggtatttgtctcgtatttttgttggttcattctttctgccaaa
cgggatttatctgctggcgcatcagaagtactttataaacaagctggttatttctctgag
gtttactctcctactgcctcaatgcttcttctttatgcgattgggttatacttgagtgcc
cagcaagcagaaaatgaaataccattctatttatctgtgggtattcccaaggataaaaaa
tatctacaagctttagagaaagctcttggcacattagcacgatggccacatgataataca
tctttggtcacatacttggactctttggagtttattagcaaggtattattacagcaagtg
gatacactttggaagaacttctctgaaggaaaaccaacccattattctggtaacatgaac
tatgtcttgacagcattgcatcagttcgctgattccagcttcacgtcttttagctataca
caaatgtctcaaggagacaacgagagacggcatgggaccttactgaaagtccttgtatcc
gccattaaattttcctttgttaccaagaaagatgtccagaagagcttgggtttcattgtc
cgtgccatttcaagtaaatcgctagcgccagaggagctcaaattcttgataccttcgctt
agcaacattggagtgacacttcataatactggacacgttaaagaggcaccaaaggcttta
gaattgtgctgccaaacaatatgggcacacgttaggctttcttactgtagtctatcctca
aggccaaaaggaaacagcattttgatggatataattttggatgcatttgcaaggattgca
aagttggttgacactctacgtagatgcggcacagaaatagaaacaacacttgggattgtt
gtgaagagcttgtctgaattgttgtctgactgcgacaattctgaatatttcaaaggttct
tttatactgatcgaggcgtgggttaaggctgtacacaaagagtttggggataataaggtg
gatggtgctccacttctttatccatctcttttgaaaaatcggtctccatggccaattaag
ctgataggcttaatagtagagcaggagttactagcatatggattaactaaagcacaaagc
acagaattctgctctaaaatgcagataaggatcattgatgttctgttgcataaaatttac
tgttcgaaagagcattttttggagagatcaagggttcttgtaagaaaggcaggcgcactt
cgtgcatctggagtggaaaacataaaaagctgccttgagtgtttacatgatgcaatatct
ttactacaaaagatctcagaggactcatctgacgccaacattactgcaaacaatcaattg
gccattgcatactgcttgtatgcacattgtgctcaggaagacagtgctggtggggaggta
atatttgataatgctgagaaagcacttaagttatggttgaagatgggaactttcaatcat
tattctcctgacatggtcttgcaacatccatcacaaactattgtaccacttatttgtttt
ttggttgatctcttgtctatgaagggctgttttgagcttcagtttaagttgtgcaaggtc
atgataatgatgtggaagcaagaaaaattaccccttgaaaagttgctgtccttgctggtg
accaatgggcgccttagtcatgcatgctgttatctcccactggatgagcgatttctttct
attgccactgagcatcttgatgtacatagccaccatattaatttttggataaacggtttc
gaaggagacgatccttctgtctctatgtttcttcagaggatgttgcctagtgacttactt
attcctcaatcatgtaagcatccctttggaaagcagctcagttttgatgacgtcagcaaa
gctgcctcatctctggtttctgaagttacatcaaatgaccaatcaatctttctagctagc
tgtttatactatgacttgtcagaaagactttattcacgcggagaacttttccaggccttt
tcatacgcaaaagaatccctccatttgcgtaaaaagctcctaaaaaagaagttcaaactc
aaatcgggcatatctggaaatatggaaagaaaaccttgcaggcaggacttttctcttgaa
gtgtgtggcccaacaatagttgagatttggccagattctagcagatcagccagcatgaga
gattctttccttactccatggagtgtacttagatactaccttgagagcacattacaggtc
gctatgatgtacgaattgattggcaatgctgctgaagcagaagttcacttacggacagga
aaagagatatcaaatttccatggttttccagttttctgtattgtttttacatcatgtcta
ggtcaactatactgtaagcaacagctatgggatgaagcaaagagtgagtttaatcttgcc
cgagatcttcttgtgaaaaatgatgcaatcatttcatgtagaatctgcaagttaactttg
gggatatcagttgacgtgcaagttggtgacctgtcttggaatctatttgaaaaaaaattc
cagaaacagtcgacagctgatttgtctaatgctttacgcatgtaccgatgtgcaatagag
aaattgaacagcactgacttggaatattttaatgggtccaatgataatcataaaactggt
tgtcttgtgtgcagcaaagactgtagaataccgatcaaacatgaagcttatacttgtcga
aaagaacccacaacttcaaaggatgaatcgttctctccatgtagtgtttgcatggcaata
caaattcgaagaaaaaggtcagggaatgctgaagctggtccaccattagatgctaaagct
aagaggccatccagaaattcatcacgtttagccaatgaacagaatgtagagactgttgcg
aagattagaactcgctctagtaagcgtaatgcacatatgaaaagcgaaaaggtttcaact
gagctaaatagtaaaaataacatatcttggggtgatgaattggctgcagatattttggtt
tgtggtgaaggtgagtgttttcctgatagaattggtcgcagcaaagatgacttatgcaat
atgtttggttgttggaactgccttttggttaaaaccttgaattcagagtgcatacagaat
attctgcagctgagattggactgtgttcgccgccgctaccatgtgtcagctctattaaaa
aaagctagagccttgggatctcatagcaatggggaccatgaagttcatagtgtctattgg
aagtgcatatcattgctgttcttcaggtcccttccacaggattgctataggacttatggg
ccttatttaattggactactcatggataggagcattattggtgatcttcttcctttagag
tgtgcacaaatactatggagtatgagcttcttcatgctaaaaagctccctttctgaacag
ccaagggacatctgctgtatcttctctagtgtaaaaatggctgatgttgttccctggttg
ctcaaagcttttgttctatccagagagagcccctcaatcattcaggaggtttgcaagtta
cttgcatgcatattcttgctatcaactatagattcttcaattcagctgcctttgggttct
cacaaagaatctctttctttgaatcactgggccgcatacttccatcaagtttctgtggga
acttatctcaattgtcattttcctagcttacaagcgtcgtcagaggaaaagggcacccat
gaagatttcagaaatgagacggatgatgatgtttcggaatttctcaggttgtcatcaagg
gacataatacatattgagaaacatatgacagaattcttccaaaaacttcctaatgtacca
gttctgtgcattagtatgcttggaggtgattatgttaatccccttttgaaattccatcgc
catcccctgtttttccgtgcttggatattgctttcaaggtttgattcaacaagtgaacct
actacattgcttcttccagtggatgctatttcagaaatgcagtttgaagattcctgtatc
aaagatttgggtaatccgacgagggttttagataagaagtggcagtgcccttggggctat
ggaattacagatgatgtggccccaattttcagaaatatacttgaggagaattttatgtcc
ctctccagtgcacccctgtctattaatgatgtaaatgcagatcatgtcaggtggtggtcg
catagaaagaagctcaacaattaccttgctaacacactgaaagacattgaaaattcttgg
tttggaccctggaaatgccttctgttgggccatcgattatctgatgaacacattgaggct
gcattatcaagtattatcacttatctggatacagaattcgaatttgaagccaatccagtg
ctcatcagagctatccttggtggtgctgtgtcagtggatgaagtacaagaatgttttctc
caactcattttgtataaaggttactttggaaggggagggtgctgtgggaaagatagactt
agagctttctcttcctgccaaatggatgatggagctatggacacactccaatgtttaata
acagatgcagtatatgagttgcctcagccagatggtagaggtccagttattttagttctt
gatgtcaatgttcagatgcttccttgggagaacctgcctgtactaaggaatcaagaaatt
tatcgcatgccatcaataggtagcatctttttagcattatcgcgaaacaataatgcttac
aaggatcctctttttcctgtgatcgatcctttcaatacatattatctgttgaatcctagc
ggtgacctgagcagcacgcaagaagaatttgatcagttattcagaaactacgagtggaag
ggattggctgggaattctccagaggctgatgagctcgtcttggccttgacaaatcatgac
cttttcctgtacttcgggcatggaagtggagcccagtatatttctagtaaggaaatcgag
aagatacataactgtgccgctgctcttcttatgggatgtagtagtggaacactttattgc
aaagggagttatgctcctcgaggggccccgttatcatatttatttgctggttcccctgct
atcattgcgaatctctgggatgtttctgataaggatattgatcggtttagtaaagctttg
ctcaattcgtggttgcacgacaattctctagatggcaacaattgttcaaaatgttgccag
ctaacaaaggaacttgagtccatgagtatagcttccgaagaaaaaggtagagcaagacga
cgaggcacacgaggaaataagcaacaacaaataagtgatagtaccaagtgctgcagctgc
aggcagaggcgaatagcttcatctctaagtgaagctaggcgggcttgcaagcttccactt
ctgataggcgcatctcctgtgtgttatggtatgccaacaatcattaagaagaaagtaatg
acggattctgccacgagatga

DBGET integrated database retrieval system