KEGG   Sorghum bicolor (sorghum): 8079563Help
Entry
8079563           CDS       T01086                                 

Definition
(RefSeq) glutamyl-tRNA(Gln) amidotransferase subunit A, chloroplastic/mitochondrial
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
sbi  Sorghum bicolor (sorghum)
Pathway
sbi00970  Aminoacyl-tRNA biosynthesis
sbi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sbi00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    8079563
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:sbi03029]
    8079563
Enzymes [BR:sbi01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     8079563
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     8079563
Mitochondrial biogenesis [BR:sbi03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    8079563
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-GeneID: 8079563
NCBI-ProteinID: XP_002447204
UniProt: C5Y8Z8
Position
6
AA seq 541 aa AA seqDB search
MPPPLQAHRLLISHRRLPSPARRRFTAASSLQSAPATTLAPGPATSSILSIRESLLSGER
TAADITSEYLSRLRRTEPSLRSFIHVADAAAEREAEELDRRIASGEKDAVGPLAGVLVGV
KDNLCTANMPSTGGSRILDGYRPAYDATAVRRLQEAGAIVVGKTNLDEFGMGSTTEGSAF
QVTTNPWDDSRVPGGSSGGSASAVSARQCVVSLGSDTGGSVRQPASFCGVVGLKPTYGRV
SRFGLMAYASSLDVVGCFGSSVFDTATILSVVAGHDKMDSTSSSQVVPDYASELVSLDLL
ESKPLAGLRIGIIQETLGEGVANGVISSIKGAASHLEQLGSVVEEVSLPSFSLGLPAYYI
LASSEASSNLSRYDGIRYGRQFSADDLNELYGESRANGLGHEVKMRILMGTYALSAGYYD
AYYKRAQQVRTLVKESFKDALERYDILISPAAPSAAYKIGEKINDPLAMYAGDILTVNVN
LAGLPALVVPCGFVEGGPAGLPVGLQLIGSPFCEGNLLRVGHIFEQTLQNLSFVPPLLAE
S
NT seq 1626 nt NT seq  +upstreamnt  +downstreamnt
atgccgccgcctctccaggcccaccgcctcctcatctcccaccgccgcctcccctctccc
gctcgccgccggttcaccgccgcgtcttccctccaatccgctcccgccacaaccctggcc
ccgggtcccgccacatcctccatcctctccatccgcgagtcgctcctttccggcgagagg
acagcggcggacatcacctccgagtacctctcccgcctccgccgtaccgagccgagcttg
cgcagcttcatccacgtcgcggacgccgccgccgagcgggaggcggaggaactcgaccgg
aggattgcgtccggggagaaggatgcggtggggccgctcgctggagtgctggtgggagtg
aaggacaacctctgcaccgccaacatgccctccacgggcgggtcgcggatactagacggg
taccggccggcgtacgacgccacggccgtgcggcggctgcaggaggccggcgctattgtg
gtggggaagacgaacctcgacgaattcggaatggggagcaccaccgagggctccgcgttt
caggtgacgacaaacccgtgggatgattcacgtgtgcctgggggatcctctggtggttct
gcttctgcggtatctgctaggcaatgtgtagtgtcactaggaagcgacacaggggggagt
gtgagacaaccagcgtcattttgcggtgtagtggggttgaagccaacttatggtcgggtt
tctcgttttggtctcatggcctatgcttcatcgctggatgttgtgggatgctttggttca
tctgtttttgacactgcaaccatcttatctgttgttgctggccatgacaagatggactca
accagcagttcacaggttgttccagactatgcatcggagttggtctccctagatttacta
gaatcaaaaccattggctggtctgagaattgggattatacaagaaactcttggagaaggt
gttgccaacggagtcatatcatcaatcaagggtgctgcttcacacctggagcagttggga
tctgtagtggaagaggtttcactgccttcattttctcttggcttaccagcatattacata
ctagcctcatctgaagcttcttctaatctatcacgctatgatggtatcaggtatggaaga
cagttttcagctgatgacttgaatgagctttatggagagtccagggctaatggtttgggt
catgaggtcaaaatgagaattttgatgggaacctatgctctttctgccgggtactatgat
gcatactacaaacgagcacaacaggtgaggacactggttaaggaaagcttcaaagatgct
ttggaaagatatgacattctaatttcaccagctgcgccatcagcagcctacaagataggt
gaaaagataaatgatccattagccatgtacgcaggagatatcttgacggtgaatgttaat
ttggcgggtcttcctgcattggttgtgccttgtggatttgttgaaggtggacctgcaggg
ctcccagttggacttcagctgatcggatctccattctgtgaggggaatttgctgagagta
ggccacatctttgagcagactcttcagaatctcagctttgttccaccgttgttggcagag
agctag

DBGET integrated database retrieval system